Loading...
HomeMy WebLinkAbout01-14-2025 Work Session & Regular Meeting PacketAGENDA City Council Meeting Tuesday, January 14, 2025 at 5:30 PM Anna Municipal Complex - Council Chambers 120 W. 7th Street, Anna, Texas 75409 The City Council of the City of Anna will meet on 1/14/2025 at 5:30 PM in the Anna Municipal Complex-Council Chambers, located at 120 W. 7th Street, to consider the following items. Welcome to the City Council meeting. If you wish to speak on an Open Session agenda item, please fill out the Opinion/Speaker Registration Form and turn it in to the City Secretary before the meeting starts. 1. Call to Order, Roll Call, and Establishment of Quorum. 2. Closed Session (Exceptions). Under Tex. Gov't Code Chapter 551, the City Council may enter into Closed Session to discuss any items listed or referenced on this Agenda under the following exceptions: a. Consult with legal counsel regarding pending or contemplated litigation and/or on matters in which the duty of the attorney to the governmental body under the Texas Disciplinary Rules of Professional Conduct of the State Bar of Texas clearly conflicts with Chapter 551 of the Government Code (Tex. Gov’t Code 551.071). b. Discuss or deliberate the purchase, exchange, lease, or value of real property Tex. Gov’t Code §551.072). c. Discuss or deliberate Economic Development Negotiations: (1) To discuss or deliberate regarding commercial or financial information that the City has received from a business prospect that the City seeks to have locate, stay, or expand in or near the territory of the City of Anna and with which the City is conducting economic development negotiations; or (2) To deliberate the offer of a financial or other incentive to a business prospect described by subdivision 1). (Tex. Gov’t Code §551.087). d. Discuss or deliberate personnel matters (Tex. Gov’t Code §551.074). City Council. The Council further reserves the right to enter into Executive Session at any time throughout any duly noticed meeting under any applicable exception to the Open Meetings Act. 3. Consider/Discuss/Action on any items listed on any agenda - work session, regular meeting, or closed session - that is duly posted by the City of Anna for any City Council meeting occurring on the same date as the meeting noticed in this agenda. 4. Adjourn. This is to certify that I, Carrie L. Land, City Secretary, posted this Agenda on the City’s website www.annatexas.gov) and at the Anna Municipal Complex bulletin board at or before 5:00 p.m. on 1/10/2025. Carrie L. Land, City Secretary AGENDA City Council Meeting Tuesday, January 14, 2025 at 6:00 PM Anna Municipal Complex - Council Chambers 120 W. 7th Street, Anna, Texas 75409 The City Council of the City of Anna will meet on 01/14/2025 at 6:00 PM in the Anna Municipal Complex-Council Chambers, located at 120 W. 7th Street, to consider the following items. Welcome to the City Council meeting. If you wish to speak on an Open Session agenda item, please fill out the Opinion/Speaker Registration Form and turn it in to the City Secretary before the meeting starts. 1. Call to Order, Roll Call, and Establishment of Quorum. 2. Invocation and Pledge of Allegiance. 3. Neighbor Comments. At this time, any person may address the City Council regarding an item on this meeting Agenda that is not scheduled for public hearing. Also, at this time, any person may address the City Council regarding an item that is not on this meeting Agenda. Each person will be allowed up to three (3) minutes to speak. No discussion or action may be taken at this meeting on items not listed on this Agenda, other than to make statements of specific information in response to a citizen’s inquiry or to recite existing policy in response to the inquiry. 4. Reports. Receive reports from Staff or the City Council about items of community interest. Items of community interest include: expressions of thanks, congratulations, or condolence; information regarding holiday schedules; an honorary or salutary recognition of a public official, public employee, or other citizen (but not including a change in status of a person's public office or public employment); a reminder about an upcoming event organized or sponsored by the governing body; information regarding a social, ceremonial, or community event organized or sponsored by an entity other than the governing body that was attended or is scheduled to be attended by a member of the governing body or an official or employee of the municipality; and announcements involving an imminent threat to the public health and safety of people in the municipality that has arisen after the posting of the Agenda. 5. Work Session. a. Review City of Anna 2025-2026 Strategic Work Plan. (Assistant City Manager Taylor Lough) b. Proposed Development at US-75 and the Collin County Outer Loop (City Manager Ryan Henderson) 6. Consent Items. These items consist of non-controversial or "housekeeping" items required by law. Items may be considered individually by any Council Member making such request prior to a motion and vote on the Consent Items. a. Approve City Council Minutes for December 17, 2024. (City Secretary Carrie Land) b. Review Minutes of the December 5, 2024, Joint Community Development Corporation and Economic Development Corporation Board Meeting. (Director of Economic Development Bernie Parker) c. Approve a Resolution setting a Public Hearing under Sections 372.009 and 372.011 of the Texas Local Government Code on the Advisability of the Dissolution of the Crystal Park Public Improvement District within the Corporate Limits and extraterritorial jurisdiction of the City of Anna, Texas; and Authorizing the Issuance of Notice by the City Secretary of Anna, Texas regarding the Public Hearing. (Director Economic Development Bernie Parker) d. Approve a Resolution authorizing the City Manager to execute Amendment Proposal Number 5 for the Hurricane Creek Regional Wastewater Treatment Plant Construction. (Public Works Director Steven Smith) 7. Items For Individual Consideration. a. Conduct a Public Hearing/Consider/Discuss/Action on an Ordinance to amend an existing Planned Development (Ord. No. 648-2014) to allow for a commercial drone delivery hub as an accessory use, located on the west side of Buddy Hayes Boulevard, 265± feet north of W. White Street. Zoned Planned Development (Ord. No. 648-2014). (PD 24-0005) (Director of Development Services Stephanie Scott-Sims) b. Consider/Discuss/Action on a Resolution approving an Ordinance reducing the maximum prima facie speed limit on State Highway 5. (Assistant City Manager Greg Peters, P.E.) c. Consider/Discuss/Action on a Resolution authorizing the City Manager to execute an agreement with the Northpointe Crossing Homeowner's Association for the design and construction of drainage improvements for an unnamed tributary of Sweetwater Creek, approved as to form by the City Attorney. Assistant City Manager Greg Peters, P.E.) d. Consider/Discuss/Action on a Resolution approving an amendment to Master Agreement for Professional Services 2021-2026 with Freese & Nichols, Inc. with a Professional Services Project Order (PSPO) for planning work associated with an update to the park system master plan. (Park Planning and Development Manager, Dalan Walker, RLA) 8. Closed Session (Exceptions). Under Tex. Gov't Code Chapter 551, the City Council may enter into Closed Session to discuss any items listed or referenced on this Agenda under the following exceptions: a. Consult with legal counsel regarding pending or contemplated litigation and/or on matters in which the duty of the attorney to the governmental body under the Texas Disciplinary Rules of Professional Conduct of the State Bar of Texas clearly conflicts with Chapter 551 of the Government Code (Tex. Gov’t Code 551.071). b. Discuss or deliberate the purchase, exchange, lease, or value of real property Tex. Gov’t Code §551.072). c. Discuss or deliberate Economic Development Negotiations: (1) To discuss or deliberate regarding commercial or financial information that the City has received from a business prospect that the City seeks to have locate, stay, or expand in or near the territory of the City of Anna and with which the City is conducting economic development negotiations; or (2) To deliberate the offer of a financial or other incentive to a business prospect described by subdivision 1). (Tex. Gov’t Code §551.087). d. Discuss or deliberate personnel matters (Tex. Gov’t Code §551.074). City Council. The Council further reserves the right to enter into Executive Session at any time throughout any duly noticed meeting under any applicable exception to the Open Meetings Act. 9. Consider/Discuss/Action on any items listed on any agenda - work session, regular meeting, or closed session - that is duly posted by the City of Anna for any City Council meeting occurring on the same date as the meeting noticed in this agenda. 10. Adjourn. This is to certify that I, Carrie L. Land, City Secretary, posted this Agenda on the City’s website www.annatexas.gov) and at the Anna Municipal Complex bulletin board at or before 5:00 p.m. on 01/10/2025. Carrie L. Land, City Secretary Item No. 5.a. City Council Agenda Staff Report Meeting Date: 1/14/2025 Staff Contact: Taylor Lough AGENDA ITEM: Review City of Anna 2025-2026 Strategic Work Plan. (Assistant City Manager Taylor Lough) SUMMARY: Staff will provide a presentation outlining the 2025-2026 operational work plan using the adopted City of Anna Success Statements framework for City Council review and feedback. FINANCIAL IMPACT: This item has no financial impact. BACKGROUND: On January 24, 2023, the City Council approved a Resolution adopting City of Anna Success Statements. This action followed a workshop held on December 9 and 10, 2022, in which members of the City Council drafted seven Strategic Outcome Areas that help define Anna's future identity. Members of the City Council met in August 2024 to develop a Vision Statement, which has been added to the Strategic Framework. A meeting with the facilitator on November 4, 2024 confirmed the Strategic Outcome Areas and Vision. Memorandum 24-163 provided a comprehensive list of accomplishments achieved during fiscal year 2024 (October 1, 2023 – September 30, 2024) STRATEGIC CONNECTIONS: This item supports the City of Anna Strategic Plan, specifically advancing the strategic outcome area: Excellent. ATTACHMENTS: 1. Anna-TX-Strategic-Framework-v1 2. 2025-2026 Work Plan Update 3. Memorandum 24-136- FY24 Accomplishments Strategic Framework Neighborly Anna’s community of neighbors has a sense of hometown pride and is: Caring and giving Engaged in the community Active in civic life Unique Anna is designed to be unique as it transforms from a bedroom community to a thriving city, with: Deliberate planning for the future A vision for innovative development and positive growth A variety of housing, jobs, and educational opportunities Vibrant Anna has a quality workforce that contributes to a prosperous economy that includes: Diverse businesses with outstanding employment opportunities Easy access to a variety of events and entertainment venues A one-of-a-kind downtown Safe Anna is a community where neighbors feel safe due to the City’s commitment to: Staffing public safety operations to meet the needs of a growing community Preparing for emergencies and ensuring excellent response times Resilient Anna’s mobility and utility infrastructure consistently meets community needs by: Focusing on resiliency and the City’s ability to recover from upsets Having a robust multi-modal transportation network Dependably delivering utility services to the City’s neighbors and businesses Active The City of Anna promotes an active community through: A variety of social opportunities for neighbors and visitors Diverse recreational venues Well-maintained trails and natural areas Opportunities for lifelong learning Excellent Anna is a high-performing City that implements best practices and pursues accreditation, demonstrating its commitment to: Ethical and collaborative decision-making Continuous improvement and achieving measurable outcomes Ensuring a positive work environment for Council, staff, and neighbors Strategic Outcome Areas Vision Anna is a vibrant, economically thriving community with a diversity of quality transportation options, housing inventory, and destination attractions. Our world-class facilities, services, and infrastructure attracts residents, businesses, and visitors and drives our financial stability and sustainability. 2025-2026StrategicWork Plan Tuesday, January 14, 2025CityCouncilMeeting December 2022 members of City Council met with facilitator to set direction for the future of Anna. City Council adopted Success Statements at their meeting on January 24, 2023. November 4, 2024, members of City Council met with facilitator to review direction for the future of Anna. Staff met the following day to discuss implementation of the Strategic Framework. BACKGROUND Strategic Vision The vision for the City of Anna is to be a vibrant, economically thriving community with a diversity of quality transportation options, housing inventory, and destination attractions. Our world-class facilities, services, and infrastructure will attract residents, businesses, and visitors and drive our financial stability and sustainability. The following slides feature each Strategic Outcome Area with the Success Statement and Current Activities followed by: An update on the implementation for each Strategic Outcome Area: This item has been substantially completed. This item is underway. This item has been removed from the work plan. Additional work plan items that have been accomplished and included in green. New work plan items planned for 2025-2026 have been added. OVERVIEW SUCCESS STATEMENT Anna’s community of neighbors has a sense of hometown pride and is: Caring and giving Engaged in the community Active in civic life CURRENT ACTIVITIES Food, clothing, toy drives, days of service Community Leadership programs and events Neighbor recognition like the ‘We Notice’ and ‘A Veteran Lives Here’ Campaigns Block party and Community Built Here trailers Community partnerships NEIGHBORLY Enhance Boards and Commission experience by refining orientation, communication, recruitment, and recognition ( Fall 2024) Implemented youth internship program (Summer 2024) and hosted eight AISD teacher “externs” Relaunched ‘I Love My City’ beautification program (Fall 2024) Evaluate, prepare and hold 2025 community survey (Fall 2025) NEIGHBORLY WORK PLAN Keep Texas Beautiful won the 2024 Governor’s CommunityAchievementAward (GCAA) and $180,000 for a TxDOTlandscapingproject. Hosted first Service and Leadership Symposium w/ local non-profits. Hosted the first North Collin County HOA Legal Clinic andcontinuedtheNorthCollinCountyNeighborhoodConference. Provided 100 tree saplings to neighbors for Arbor Day. Collected 471 pounds of peanut butter to benefit the NorthTexasFoodBank. This is an increase of almost 400 pounds fromlastyear’s Peanut Butter Drive. NEIGHBORLY WORK PLAN Appoint Charter Review Commission (Fall 2025) Evaluate, prepare and hold 2025 community survey (Fall 2025) Elicit public input on ADA Transition Plan (Winter 2025) NEIGHBORLY WORK PLAN 2025 - 2026 SUCCESS STATEMENT Anna is designed to be unique as it transforms from a bedroom community to a thriving city, with: Deliberate planning for the future A vision for innovative development and positive growth A variety of housing, jobs, and educational opportunities CURRENT ACTIVITIES Anna 2050 Comprehensive Plan Economic Development Strategic Plan and annual report Professional development and education on latest trends in local government UNIQUE Awarded Silver Scenic City Texas certification (Fall 2024) Update Fire Codes to 2021 IFC (Winter 2025) Updates to the Future Land Use Plan and The Master Thoroughfare Plan (Fall 2024) Updates to water and sewer Master Plans for new development patterns (Winter 2025) UNIQUE WORK PLAN Streamlined plan review processes to reduce time to approve platting Adopted the 2021 International Code Council (ICC) Family Building and 2020 National Electric Codes Awarded Gold MarCom for tradeshow booth and banners Sponsored DCEO Real Estate and Dallas Business Journal BRED awards Won 2024 Gold Level AVA Digital Award for exceptional work on 2023 Building Momentum Annual Report Created Public Improvement Districts (PID) for AnaCapri North, Rockhill and Liberty Hills UNIQUE WORK PLAN Updates to the Future Land Use Plan (Spring 2025) and The Master Thoroughfare Plan (Fall 2025) Prepare amendments to the Zoning Ordinance and Subdivision Regulations to improve clarity and to implement results from the Anna 2050 Comprehensive Plan update (Winter 2025) Begin public outreach for a city initiated rezoning effort for the Anna Downtown District (Spring 2026) Updates to water and sewer Master Plans for new development patterns (Fall 2025) Update International Building Codes to 2024 (Fall 2025) UNIQUE WORK PLAN 2025 - 2026 SUCCESS STATEMENT Anna has a quality workforce that contributes to a prosperous economy that includes: Diverse businesses with outstanding employment opportunities Easy access to a variety of events and entertainment venues A one-of -a-kind downtown CURRENT ACTIVITIES Downtown Master Plan Business attraction program Art programming Hosting and partnering to host job fairs VIBRANT Reconstruct 5th, 7th, and Riggins with on-street parking (Fall 2024) Create and implement downtown marketing plan (Summer 2024) Host medical attraction event (Summer 2024) Design Interurban pedestrian corridor (Fall 2024) Construct Plaza (Spring 2025) Advance wayfinding program by designing 75 gateways and constructing parks and facilities signs (Winter 2025) VIBRANT WORK PLAN Expanded student art contests to include both AISD middle schools and high school students. Selected pieces are hanging on a new display within the Municipal Complex. Held 4th Annual Development Forum and Downtown Business Breakfast. Received a CBDG Grant in the amount of $500,000 for Downtown infrastructure improvements. Acquired 5 acres for future downtown development. Installed lights on Sherley Water Tower downtown. VIBRANT WORK PLAN Construct Plaza (Spring 2025) Interurban pedestrian corridor (Fall 2025) Construct CDBG Grant Improvements, including pedestrian improvements on 4th Street, and paving/drainage improvements at Edwards/Riggins (Fall 2025) Advance wayfinding program by designing US 75 gateways and constructing parks and facilities signs (Winter 2025) VIBRANT WORK PLAN 2025 - 2026 SUCCESS STATEMENT Anna is a community where neighbors feel safe due to the City’s commitment to: Staffing public safety operations to meet the needs of a growing community Preparing for emergencies and ensuring excellent response times CURRENT ACTIVITIES Strategic and staffing plans Employee recruitment, retention, and training efforts Neighbor outreach and engagement Interlocal partnerships SAFE Open Fire Station 2 (Summer 2024) Receive delivery and configure Medic 3 (Summer 2024) Took delivery of Emergency Medical Services utility vehicle and placed into service (Summer 2024) Implement police drone program (Fall 2024) SAFE WORK PLAN Baylor Scott & White Recognitions: Life Saving Award, Stroke Award, Outstanding EMS Documentation Award, EMS Partner of the Year. Released Long-Range Master Plan, Community Risk Assessment (CRA), Standards of Cover, and Strategic Plan. Implemented a bicycle unit for use in neighborhood patrols and special events. Created the Joint Agency Accident Investigation Team with City of Melissa Police Department & obtained signed MOU. Expanded the Peer Support Program and partnering with F1RST. Developed a Civilian Response to Active Shooter (CRASE) curriculum and made training available to the public. Launched a women’s self-defense course. SAFE WORK PLAN Take delivery of Engine 3 and place into service (Summer 2025) Review expansion of police partnerships with Princeton, Melissa, and Celina (Summer 2025) SAFE WORK PLAN 2025 - 2026 SUCCESS STATEMENT Anna’s mobility and utility infrastructure consistently meets community needs by: Focusing on resiliency and the City’s ability to recover from upsets Having a robust multi-modal transportation network Dependably delivering utility services to the City’s neighbors and businesses CURRENT ACTIVITIES Community Investment Program Transportation Thoroughfare Plan Risk and Resiliency Plans Increase water and sewer capacity RESILIENT Conduct railroad crossing study (Summer 2024) Complete construction of Leonard Avenue to Collin County Outer Loop ( Fall 2024) Open Rosamond Avenue from SH5 to County Road 425 (Summer 2024) Repurpose existing Collin Pump Station generator for use at Fire Station 2 ( Fall 2024) Complete construction of water main and fire hydrant upgrades for Downtown Phase 2, FM 455 Phase 1, and Slater Creek Road (Winter 2024) Develop priority plan for management of stormwater utilities ( Winter 2024) Review senior transit partnerships and funding opportunities (Fall 2024) RESILIENT WORK PLAN Completed FM 455 Water Line project. Completed Hurricane Creek Trunk Sewer line. Completed SH 5 Utility Relocation Phase 1. Completed Finley Blvd. project. RESILIENT WORK PLAN Review senior transit partnerships and funding opportunities (Fall 2025) Complete update to Water Model (Summer 2025) Construct 2 additional lanes of Rosamond Parkway from US 75 to Buddy Hayes (Fall 2025) Review future bond authorization to fund capital improvements ( Fall 2025) Complete County Road 289 Waterline project (Fall 2025) Complete Hurricane Creek Interceptor Line North project (Fall 2025) Review HOA Drainage Assistance Policy (Spring 2025) RESILIENT WORK PLAN 2025 - 2026 SUCCESS STATEMENT The City of Anna promotes an active community through: A variety of social opportunities for neighbors and visitors Diverse recreational venues Well -maintained trails and natural areas Opportunities for lifelong learning CURRENT ACTIVITIES Parks, Trail, and Open Space Master Plan and Parks Capital Improvement Plan Festivals, classes, events Community and employee wellness events Police Explorer program and student partnership programs Volunteer program ACTIVE Construct Natural Springs Playground with community build component (Summer 2024) Begin Construction of Pecan Grove Trail (Summer 2024) Develop and implement digital library services (Fall 2024) Complete design for Anna Crossing Park (Spring 2025) Open Anna Community Library (Fall 2025) Activate Municipal Complex Plaza (Winter 2025) Develop implementation plan for key trail and hike/bike improvements (Summer 2024) ACTIVE WORK PLAN Boots and Booms recognized 2024 Texas Festivals and Events Association (TFEA) Bronze Awards in Onsite Décor and Radio Promotions. Completed Henry Clay “Yank” Washington Park development. Completed Bryant Park Master Plan. Completed Slayter Creek Park improvements: fitness court and shade structure, pickleball courts, basketball courts and lighting, restroom. Hosted seven Special Events, including Easter Eggstravaganza, Touch-a-Truck, Summer Splash, Juneteenth, Boots and Booms, AnnaFest, 12 Days of Anna Tree Lighting, Ice Skating, reindeer and first drone light show. Enhanced the adaptive Easter Egg Hunt, hosting the event at the splash pad. Partnered with Anna ISD for the first Multicultural Night. ACTIVE WORK PLAN Implement digital library services (Spring 2025) Open Anna Community Library (Fall 2025) Activate Municipal Complex Plaza (Winter 2025) Begin construction on Anna Crossing Park (Fall 2025) Complete update to Parks, Trails, and Open Space Master Plan ( Fall 2025) Develop implementation strategy for key trail and hike/bike improvements (Fall 2025) ACTIVE WORK PLAN 2025 - 2026 EXCELLENT Anna is a high-performing City that implements best practices and pursues accreditation, demonstrating its commitment to: Ethical and collaborative decision-making Continuous improvement and achieving measurable outcomes Ensuring a positive work environment for Council, staff, and neighbors EXCELLENT CURRENT ACTIVITIES Employee training and wellness opportunities Internal standard operating procedures Routine management training and team building Ongoing awards, accreditation and recognition programs Complete implementation of refreshed applicant tracking system to improve user interface and experience (Summer 2024) Implement and transition software for Municipal Court (Fall 2024) Complete Public Works self-accreditation (Winter 2024) Attain Texas Police Chiefs Association accreditation (Winter 2025) EXCELLENT WORK PLAN Maintained Aa2 rating with Moody’s and upgraded the Anna CDC to Aa2. Government Finance Officers Association (GFOA) Distinguished presentation award for the FY25 Budget. Received the GFOA Certificate of Achievement for Excellence in Financial Reporting for the FY2022 Annual Report. Creation of internal organizational pillars (values). 2024 Texas Association of Telecommunications Officers and Advisors ( TATOA) awarded Anna Fest 3rd place in Event Program/Promotion and “ Recreating a Skate Park” 3rd place in Documentary. EXCELLENT WORK PLAN Texas Association of Municipal Information Officers (TAMIO) awarded Anna 1st place in Best Strategic Plan and Best Use of Humor, 2nd place for Best Electronic Report, and 3rd place for Best Short-Form Videos. Awarded three Savvy Awards from 3CMA: 1st in social media campaign category for Touch-a-Truck promotion, 3rd for specific use website for the police department, and 3rd in digital interactive electronic news for the City Manager Monthly Report. Launched weekly YouTube programming featuring updates from the City Manager, and City Council and Parks Advisory Board meetings. EXCELLENT WORK PLAN Complete Public Works Self-Accreditation Application ( Summer 2025) Attain Texas Police Chiefs Association accreditation ( Winter 2025) Update Annual Comprehensive Financial Report (Spring 2025) Implement internal employee recognition program ( Spring 2025) Monitor and report on State of Texas 89th Legislative Session ( Spring 2025) EXCELLENT WORK PLAN 2025 - 2026 NEXT STEPS Questions? Comments? Feedback? Continue presentations with updates on individual items throughout the year. Annual Strategic Work Plan Update. 2025-2026StrategicWork Plan Tuesday, January 14, 2025CityCouncilMeeting Memorandum Memorandum No: 24-136 Date: October 18, 2024 To: The Honorable City Council From: Ryan Henderson, City Manager Re: Fiscal Year 2024 Accomplishments The 2023-2024 fiscal year resulted in the completion of numerous key accomplishments, of which the City of Anna can be proud. To organize these accomplishments, the following sections are included herein: Noteworthy City Council Activities and Special Projects Neighborly o Community Enhancement and Compliance o Public Affairs Unique o Development Services Vibrant o Economic Development Safe o Fire o Police Resilient o Capital Projects o Public Works Active o Parks Maintenance and Capital Projects o Recreation and Library Services Excellent o City Manager’s Office o City Secretary’s Office o Finance o Information Technology o Human Resources o Organizational Developments FY 25 Objectives Noteworthy City Council Activities and Special Projects Moody’s upgraded the Anna Community Development Corporation’s credit rating from Aa3 to Aa2. The City of Anna maintained its Aa2 credit rating with Moody’s. Attended Texas Municipal League’s 113th Annual Conference. Received Silver Scenic City Texas designation. Attended the Texas Municipal League’s New Elected Officials’ Orientation. Held a facilitated retreat focused on collaborative leadership, development of a vision statement and reviewing the Governance Guide. Made 19 appointments and reappointments to volunteer boards and commissions. Updated boards and commissions appointment dates, moving appointments to the city election to January. Celebrated graduation of the 4th and 5th Neighbor Academy cohorts. Appointed Ryan Henderson as City Manager. Neighborly o Community Enhancement and Compliance Keep Anna Beautiful received the Category 5 Governor's Community Achievement Award for efforts in community improvement. Provided 9 environmental education classes in collaboration with Texas A&M Agri- Life & Grace Place Community Garden. Hosted Earth Day celebration in collaboration with Household Hazardous Waste and Drug Take Back. Expanded the rental registration program by an increase in registrations of 39%. Hosted first Service and Leadership Symposium w/ local non-profits. Hosted the first North Collin County HOA Legal Clinic and continued the North Collin County Neighborhood Conference. Handed out 100 veterans recognition yard signs. Provided 100 tree saplings to neighbors for Arbor Day. Expanded student art contests to include both AISD middle schools and high school students. Selected pieces are hanging on a new display within the Municipal Complex. o Public Affairs Awarded 1st place for Best Strategic Plan and Best Use of Humor, 2nd Place in Aware of Excellence for Best Electronic Report for the City Manager’s Report and 3d Place Aware of Honor for Best Short-Form Videos from the Texas Association of Municipal Information Officers (TAMIO). Awarded three Savvy Awards from 3CMA: 1st in social media campaign category for Touch-a-Truck promotion, 3rd for specific use website for the police department, and 3rd in digital interactive electronic news for the City Manager Monthly Report. Developed Anna Community Library logo and brand standards. Provided monthly report organized by Success Statement. Created citywide brand standards guide to provide rules for consistency. Launched weekly YouTube programming featuring updates from the City Manager, and City Council and Parks Advisory Board meetings. Collected 471 pounds of peanut butter to benefit the North Texas Food Bank. This is an increase of almost 400 pounds from last year’s Peanut Butter Drive. Unique o Development Services Adopted downtown development standards and regulations to ensure high- quality development. Created innovative and flexible land development techniques that permit a variety of lot sizes and housing types that will promote context-sensitive development. Incorporated standards for new residential development proposals requiring outdoor open space with amenities and community gathering places. Added standards that preserve the aesthetic quality of the city and ensure trees with historic value are preserved. Streamlined Plan Review processes to reduce the platting approval time. Adopted the 2021 International Code Council (ICC) family Building and 2020 National Electric Codes. Vibrant o Issued 33 Certificates of Occupancy, including, but not limited: Peak Physical Therapy Roma’s Italian Bistro Salad and Go Integrity Urgent Care Anna Foot and Ankle Specialists ENT Centers of North Texas Texas Roadhouse Texoma Physicians Group Clinic Hispana El Milagro Parmore multi-family Palladium East Foster multi-family 1989 Lash and Spa Chipotle Ricky’s Automotive Hanger Round Resale Shop Fire Station #2 Hu Happy Feet K Bite Walgreens Elevate Title Anna Islamic Center Total Body Training Dallas Pain Institute Plush Aesthetics Parmore Anna Senior Living Dental Wellness of Anna Country Charm Coffee Shop Kalamaki Greek Eatery Life Storage Jelsma Orthopedics Brake Plus Baylor Scott & White Outpatient Physical Therapy o Economic Development Awarded Gold MarCom for tradeshow booth and banners Sponsored DCEO Real Estate and Dallas Business Journal BRED awards. Held 4th Annual Development Forum and Downtown Business Breakfast. Received a CBDG Grant in the amount of $500,000 for Downtown infrastructure improvements. Created Public Improvement Districts (PID) for AnaCapri North, Rockhill and Liberty Hills. Executed incentive agreement with Chipotle. Co-sponsored the Anna Senior Coyotes Career Fair at the Anna High School. Acquired 5 acres for future downtown development. 61,324,239 increase in net commercial property value over last year. Over 1,000 followers on LinkedIn. Held 180 meetings with prospective and targeted primary employers, partners and landowners. Safe o Fire Baylor Scott & White Recognitions: Life Saving Award, Stroke Award, Outstanding EMS Documentation Award, EMS Partner of the Year. Released Long-Range Master Plan, Community Risk Assessment (CRA), Standards of Cover, and Strategic Plan. Completed Fire Station 2 construction project and began operations. Completed all aerial training and began Quint operations. Placed Medic 2 into service. Reached 2,461 elementary students during Fire Prevention Week (October 9-13) o Police Answered 12,042 calls for service. Implemented on-duty workout availability, attended job fairs, and enlisted the help of all Texas police academies to improve recruitment, retention, and morale. Implemented a departmental drone program. Implemented a bicycle unit for use in neighborhood patrols and special events. Created the Joint Agency Accident Investigation Team with City of Melissa Police Department & obtained signed MOU. Prioritized officer mental and physical health and resilience by expanding the Peer Support Program and partnering with F1RST. Developed a Civilian Response to Active Shooter (CRASE) curriculum and made training available to the public. Launched a women’s self-defense course and completed the first block of training. Targeted community engagement opportunities and expanded social media interactions including Back to School Bash, Cruisin with Claus, National Night Out, Anna ISD Career Day, Pizza with Police and Coffee with Cops. Continued focus on employee recruitment, retention, and morale with new programs such as on-duty workouts, attended job fairs, and enlisted the help of additional police academies. Resilient o Capital Projects Completed Leonard Avenue lanes and installed street lighting conduit. Completed Downton Street Expansion of Riggins, 5th and 7th. Completed FM 455 Water Line project. Completed Slater Creek Water Line Improvement. Installed lights on Sherley Water Tower downtown. Completed Hurricane Creek Trunk Sewer line. o Public Works Fleet and Facilities implemented preventative maintenance programs to increase vehicle longevity and reduce unexpected breakdowns. Streets Resurfaced and repaved over three miles of city streets. Initiated a street sign replacement program. Filled 1,600 potholes. Water Completed 23 main break repairs. Completed 24 leak repairs. Replaced 75 feet of public water main. Wastewater Completed 18 main break repairs. Completed 14 lateral repairs. Jetted 10 miles of sewer main. Replaced 40 feet of public sewer main. Initiated Stormwater Utility program: Cleared 63 culverts. Cleared two 100' box culverts. Cleaned 450' of drainage. Cleared North Pointe detention pond and culvert. Regraded Oak Hollow drainage. Active o Parks Maintenance and Capital Projects Completed Henry Clay “Yank” Washington Park development. Completed Bryant Park Master Plan. Completed Slayter Creek Park improvements: fitness court and shade structure, pickleball courts, basketball courts and lighting, restroom. Maintained, mowed, and treated over 576 acres of parks and facilities. Cleaned and inspected 5.5 miles of trails each week. Placed third of more than 25 cities in the DFW Directors Six Pack Event, hosted by the City of Southlake. Our team placed first in golf cart polo. Replaced the train depot decking at Sherley Heritage Park. Implemented asset management and work order system. Replaced trail at Natural Springs Park. Replaced Natural Springs Park Fountain and added aerators to the back pond. o Recreation and Library Services Hosted seven Special Events, including Easter Eggstravaganza, Touch-a-Truck, Summer Splash, Juneteenth, Boots and Booms, AnnaFest, 12 Days of Anna Tree Lighting and Ice Skating. Enhanced the adaptive Easter Egg Hunt, hosting the event at the splash pad. Partnered with Anna ISD for the first Multicultural Night. Provided logistical support to the Greater Anna Chamber of Commerce for Boo Bash, Veterans Day Parade, and Santa's Village and Parade. Offered programs for youth, teens and adults, including soccer and baseball leagues, teen Easter Glow Party, softball, cornhole, pickle ball and tennis. Provided 56 senior programs, including trips, foodie troop, crafting corner, luncheons, and book club. Increased number of programs per 1,000 population from 5.6 to 9.1. Excellent o City Manager’s Office Planned and implemented the first Youth in Government Day. Held the first Youth Employment Program, employing three interns in various departments over the summer. Hosted three Best Buddies from Anna High School, providing job training with various departments throughout the school year. Hosted eight AISD teacher “externs,” providing real life examples to take back to the Anna classrooms. o City Secretary’s Office Enrolled 170 Resolutions and 50 Ordinances. Processed over 600 Public Information Requests. Received and processed 25 applications for Boards and Commissions. Issued 29 alcoholic beverage permits. Conducted the Mayoral and Council election and runoff election. Promoted voter registration by attending city events. o Finance Received the GFOA Certificate of Achievement for Excellence in Financial Reporting for the FY2022 Annual Report. Utility Billing worked with Development Services to enhance permitting customer service. Created mobile services for Public Works to operate work orders while in the field. Municipal Court filed 3,932 citations and cleared 71%. Municipal Court issued 2,032 warrants and cleared 15%. Completed Municipal Justice software implementation. Worked with Code Compliance on citation processing and court support. o Information Technology Received over 4,000 help desk requests with 85% resolved within four work hours. Installation of new server infrastructure at the Municipal Complex. Installation of network infrastructure at the new Fire Station #2. Completed the transition of all public safety vehicles to a uniform communications solution. Implementation of Mobile Device Manager software. Installation of disaster recovery equipment at Central Fire Station. o Human Resources Implemented NEOGOV Insight applicant tracking system for greater efficiency. Developed Human Resources Department Strategic Plan 2024 – 2027. Implemented performance evaluations guide and action plan for FY2023/2024, ensuring sustainability for the future. Created a competitive compensation and benefits package to recruit and retain highly skilled talent. Implemented first “Beat the Heat” safety campaign. FY 25 Objectives (Alphabetical by Department/Division) Capital Projects o Complete County Road 289 Waterline project. o Complete SH 5 Utility Relocation Phase 1. o Complete Finley Blvd. project. o Complete County Road 289 Waterline project. o Complete Hurricane Creek Interceptor Line North project. City Manager’s Office o Refresh and implement City of Anna Strategic Success Statements annual work plan. o Update ADA Transition Plan. o Complete facilities space study to ensure high efficiency workplaces now and into the future. o Review future bond authorization to fund capital improvements. City Secretary’s Office o Hold a Boards/Volunteer's recognition event. o Receive the TMCA's Municipal Clerks Office Achievement of Excellence Award. o Review and prepare for Charter Review Commission. Community Enhancement and Compliance o Refresh the Mobile Food Establishment permitting process. o Increase rental inspection efforts regarding multi-family properties. o Utilize new payment system for Health Services. o Implement new volunteer management software. o Evaluate and enhance Keep Anna Beautiful initiative. Development Services o Review and update Anna 2050 Comprehensive Plan Land Use related sections and Future Land Use Map to reflect City Council's goals and objectives for land development. o Prepare amendments to the Zoning Ordinance and Subdivision Regulations to address issues and to implement results from the Anna 2050 Comprehensive Plan update. o Begin public outreach for a city initiated rezoning effort for the Anna Downtown District. o Complete digitalization and electronic filing of zoning & platting records. o Prepare for implementation of electronic plan review software application. Economic Development o Recruit additional tenants to the Anna Business Park. o Continue implementation of the Anna CDC/EDC Marketing Strategy. o Recruit medical and primary care businesses. o Continue implementation of the Downtown Master Plan, including design of the Interurban Pedestrian Corridor, and attract additional retailers and restaurants. Finance o Receive the GFOA Certificate of Achievement for Excellence in Financial Reporting for the FY2023 Annual Report. o Improve payment processes for neighbors. o Implement Municipal Court Juvenile Justice Program. o Maintain Transparency Stars. Fire o Take delivery of Emergency Medical Services utility vehicle and place into service. o Take delivery of Engine 3 and place into service. o Continue joint agency training to include all fire personnel. o Begin structured field training officer program for all Paramedics. o Initiate department software conversion to include appropriate time management and scheduling module. o Continue to improve training processes through collaboration with Collin College and neighboring fire departments. Human Resources o Implement internal employee recognition program for remote access and updates. o Enhance the efficiency and effectiveness of the HR department by leveraging technology for better service delivery. o Expand risk and safety programs. Information Technology o Implement endpoint management software and additional security tools. o Implement internal employee facing knowledge base and complete strategic work plan. Parks Maintenance and Capital Projects o Open the new playground at Natural Springs Park. o Finalize design and begin construction of Anna Crossing Park. o Open John Flavel Greer Park within the Woods at Lindsey Place neighborhood. o Complete construction of Pecan Grove Trail. o Complete construction of Bryant Park. o Install updated parks signage and wayfinding. Police o Obtain Texas Police Chief’s Association Accreditation. o Implement changes to recently passed CJIS compliance guidelines. o Develop a new and updated five-year staffing plan. Public Affairs o Monitor and report on State of Texas 89th Legislative Session. o Conduct second community survey. o Public Works o Complete restoration of historic fire truck. o Replace 100 sidewalk panels, 30 street name signs and 40 regulatory street signs. o Successfully complete 20 water leak repairs. o Implement water valve and hydrant program to increase maintenance levels. o Successfully jet 10 miles of sewer main. o Complete 3 drainage improvement and 3 drainage maintenance projects. o Complete maintenance and clearing of 50 drainage culverts. o Complete 1 drainage improvement project in partnership with Parks Maintenance staff. Recreation and Library Services o Increase participation in youth sports. o Complete facility enhancements and additions such as the Natural Springs playground, trails, and plaza. o Open Anna Community Library. c: Taylor Lough, Assistant City Manager Greg Peters, Assistant City Manager Carrie Land, City Secretary Clark McCoy, City Attorney Management Team Item No. 5.b. City Council Agenda Staff Report Meeting Date: 1/14/2025 Staff Contact: AGENDA ITEM: Proposed Development at US-75 and the Collin County Outer Loop (City Manager Ryan Henderson) SUMMARY: The work session item before Council is a proposed development at the NE Corner of US 75 and the Collin County Outer Loop. FINANCIAL IMPACT: This item has no financial impact. BACKGROUND: Staff has met with the owner/developer of the property at the NE Corner of US 75 and the Collin County Outer Loop. Staff has asked the owner/developer to come before the Council for feedback prior to going before the Planning and Zoning Commission. STRATEGIC CONNECTIONS: This item supports the City of Anna Strategic Plan, specifically advancing the strategic outcome area: Unique. ATTACHMENTS: Item No. 6.a. City Council Agenda Staff Report Meeting Date: 1/14/2025 Staff Contact: AGENDA ITEM: Approve City Council Minutes for December 17, 2024. (City Secretary Carrie Land) SUMMARY: FINANCIAL IMPACT: BACKGROUND: STRATEGIC CONNECTIONS: ATTACHMENTS: 1. CCmin2024-12-17 Regular Called City Council Meeting Meeting Minutes Tuesday, December 17, 2024 @ 6:00 PM Anna Municipal Complex - Council Chambers 120 W. 7th Street, Anna, Texas 75409 The City Council of the City of Anna will meetmet on 12/17/2024 at 6:00 PM in the Anna Municipal Complex-Council Chambers, located at 120 W. 7th Street, to consider the following items. Welcome to the City Council meeting. If you wish to speak on an Open Session agenda item, please fill out the Opinion/Speaker Registration Form and turn it in to the City Secretary before the meeting starts. 1.Call to Order, Roll Call, and Establishment of Quorum. Mayor Cain called the meeting to order at 6:00 PM. Members Present: Mayor Pete Cain Mayor Pro Tem Stan Carver ll Deputy Mayor Pro Tem Elden Baker Council Member Kevin Toten Council Member Jody Bills Council Member Kelly Herndon Members Absent: Council Member Lee Miller 2.Invocation and Pledge of Allegiance. Mayor Pro Tem Carver led the Invocation and Pledge of Allegiance. 3.Neighbor Comments. At this time, any person may address the City Council regarding an item on this meeting Agenda that is not scheduled for public hearing. Also, at this time, any person may address the City Council regarding an item that is not on this meeting Agenda. Each person will be allowed up to three (3) minutes to speak. No discussion or action may be taken at this meeting on items not listed on this Agenda, other than to make statements of specific information in response to a citizen’s inquiry or to recite existing policy in response to the inquiry. There were no public comments. 4.Reports. Receive reports from Staff or the City Council about items of community interest. Items of community interest include: expressions of thanks, congratulations, or condolence; information regarding holiday schedules; an honorary or salutary recognition of a public official, public employee, or other citizen (but not including a change in status of a person's public office or public employment); a reminder about an upcoming event organized or sponsored by the governing body; information regarding a social, ceremonial, or community event organized or sponsored by an entity other than the governing body that was attended or is scheduled to be attended by a member of the governing body or an official or employee of the municipality; and announcements involving an imminent threat to the public health and safety of people in the municipality that has arisen after the posting of the Agenda. Police Chief Habel introduced Assistant Police Chief Terry Eoff. 5.Consent Items. These items consist of non-controversial or "housekeeping" items required by law. Items may be considered individually by any Council Member making such request prior to a motion and vote on the Consent Items. MOTION: Council Member Toten moved to approve consent items 5.a. through 5.l. Council Member Herndon seconded. Motion carried 6-0. a.Approve City Council Minutes for November 4, November 12, and December 10, 2024. (City Secretary Carrie Land) b.Review Minutes of the October 3, 2024, Joint Community Development Corporation and Economic Development Corporation Board Meeting. (Director of Economic Development Bernie Parker) c.Review Minutes of the November 7, 2024, Joint Community Development Corporation and Economic Development Corporation Board Meeting. (Director of Economic Development Bernie Parker) d.Approve a Resolution adopting a Prohibited Technologies Policy. (IT Manager Chris Talbot) Upon consultation with legal counsel, staff recommends the City Council approve a Resolution prohibiting the use of TikTok and certain other social media applications and services on governmental devices. A RESOLUTION OF THE CITY OF ANNA, TEXAS ADOPTING A PROHIBITED TECHNOLOGIES POLICY e.Approve a Resolution and authorize the City Manager to execute an Interlocal Agreement for the 2024 Buy-Sell Program implementation for the Collin Grayson Municipal Alliance with the City of Melissa, Texas. (Director of Public Works Steven Smith) This Resolution and Interlocal Agreement allows the City of Anna to sell the unused portion of the City of Anna's apportionment of water through the Collin Grayson Municipal Alliance to the City of Melissa. A RESOLUTION RELATED TO AN INTER-LOCAL AGREEMENT BETWEEN THE CITIES OF ANNA AND MELISSA IN WHICH ANNA AGREES TO TRANSFER A PORTION OF ITS RESPECTIVE CONTRACTUAL MINIMUM ANNUAL VOLUME WATER OBLIGATION WITH THE GREATER TEXOMA UTILITY AUTHORITY TO THE CITY OF MELISSA IN EXCHANGE FOR AN AGREED PAYMENT FROM MELISSA AND AUTHORIZING THE EXECUTION AND ADMINISTRATION OF SAID INTER-LOCAL AGREEMENT f.Approve a Resolution and authorize the City Manager to execute an Interlocal Agreement for the 2024 Buy-Sell Program implementation for the Collin Grayson Municipal Alliance with the City of Van Alstyne, Texas. (Director of Public Works Steven Smith) This Resolution and Interlocal Agreement allows the City of Anna to sell the unused portion of the City of Anna's apportionment of water through the Collin Grayson Municipal Alliance to the City of Van Alstyne. A RESOLUTION RELATED TO AN INTER-LOCAL AGREEMENT BETWEEN THE CITIES OF VAN ALSTYNE AND ANNA IN WHICH ANNA AGREES TO TRANSFER A PORTION OF ITS RESPECTIVE CONTRACTUAL MINIMUM ANNUAL VOLUME WATER OBLIGATION WITH THE GREATER TEXOMA UTILITY AUTHORITY TO THE CITY OF VAN ALSTYNE IN EXCHANGE FOR AN AGREED PAYMENT FROM VAN ALSTYNE AND AUTHORIZING THE EXECUTION AND ADMINISTRATION OF SAID INTER-LOCAL AGREEMENTS g.Approve a Resolution of the City of Anna, Texas Approving a Remainder Area Funding and Reimbursement Agreement for The Woods at Lindsey Place Public Improvement District; Authorizing the Execution of said Agreement in the name of and on behalf of the City; and Resolving other Matters related to the Subject. (Director of Economic Development Bernie Parker) Staff recommends to approve a Resolution of the City of Anna, Texas Approving a Remainder Area Funding and Reimbursement Agreement for The Woods at Lindsey Place Public Improvement District; Authorizing the Execution of said Agreement in the name of and on behalf of the City; and Resolving other Matters related to the Subject. A RESOLUTION OF THE CITY OF ANNA, TEXAS APPROVING A REMAINDER AREA FUNDING AND REIMBURSEMENT AGREEMENT FOR THE WOODS AT LINDSEY PLACE PUBLIC IMPROVEMENT DISTRICT; AUTHORIZING THE EXECUTION OF SAID AGREEMENT IN THE NAME OF AND ON BEHALF OF THE CITY; AND RESOLVING OTHER MATTERS RELATED TO THE SUBJECT h.Approve a Resolution authorizing the City Manager to execute a Pump and Haul Agreement by and between the City of Anna Texas and MM Mantua 701, LLC, for municipal wastewater. (Assistant City Manager Greg Peters, P.E.) This item is to approve the execution of a pump and haul agreement for wastewater with a developer seeking to develop property in the Extraterritorial Jurisdiction of Van Alstyne. A RESOLUTION OF THE CITY OF ANNA, TEXAS AUTHORIZING THE CITY MANAGER TO EXECUTE A PUMP AND HAUL AGREEMENT WITH MM MANTUA 701, LLC, WITH AN EFFECTIVE DATE i.Approve a Resolution authorizing the City Manager to enter into a Project Specific Purchase Order with Kimley-Horn and Associates, Incorporated, for an update to the water model for the City of Anna, Texas. (Assistant City Manager, Greg Peters, P.E.) This item is for the approval of a project specific purchase order with Kimley- Horn and Associates, Incorporated, for professional engineering services. A RESOLUTION OF THE CITY OF ANNA, TEXAS AUTHORIZING THE CITY MANAGER TO EXECUTE A PROJECT SPECIFIC PURCHASE ORDER WITH KIMLEY-HORN AND ASSOCIATES, INCORPORATED, FOR PROFESSIONAL SERVICES PERTAINING TO WATER MODEL UPDATES, WITH AN EFFECTIVE DATE j.Approve a Resolution authorizing the City Manager to enter into a Project Specific Purchase Order with Kimley-Horn and Associates, Incorporated, for an update to the Wastewater Master Plan for the City of Anna, Texas. (Assistant City Manager, Greg Peters, P.E.) This item is for the approval of a project specific purchase order with Kimley- Horn and Associates, Incorporated, for professional engineering services. A RESOLUTION OF THE CITY OF ANNA, TEXAS AUTHORIZING THE CITY MANAGER TO EXECUTE A PROJECT SPECIFIC PURCHASE ORDER WITH KIMLEY-HORN AND ASSOCIATES, INCORPORATED, FOR PROFESSIONAL SERVICES PERTAINING TO AN UPDATE TO THE WASTEWATER SYSTEM MASTER PLAN, WITH AN EFFECTIVE DATE. k.Approve a Resolution and authorize the City Manager to execute a Master Professional Services Agreement with Project Advocates for management assistance with various Park CIP projects. (Park Planning and Development Manager Dalan Walker) Staff is seeking assistance with project management for various Park CIP projects due to the acceleration of several project timelines. The Park Planning and Development Manager will utilize the services of Project Advocates as an extension of his office in lieu of requesting additional staff positions. A RESOLUTION OF THE CITY OF ANNA, TEXAS, APPROVING A MASTER AGREEMENT FOR PROFESSIONAL SERVICES WITH PROJECT ADVOCATES, LLC. TO PROVIDE PROFESSIONAL SERVICES, INCLUDING PROJECT MANAGEMENT RESOURCES, FOR VARIOUS PARK CAPITAL IMPROVEMENT PROGRAM PROJECTS l.Approve a Resolution and authorize the City Manager to execute a Professional Service Project Order with Dunkin Sims Stoffels for the development of construction documents for Bryant Park. (Park Planning and Development Manager Dalan Walker) Staff requests City Council approval for PSPO #PARKS2 for the preparation of construction drawings for Bryant Park. A RESOLUTION OF THE CITY OF ANNA, TEXAS, APPROVING A PROFESSIONAL SERVICES PROJECT ORDER FOR DESIGN SERVICES RELATED TO BRYANT PARK BY DUNKIN SIMS STOFFELS. 6.Items For Individual Consideration. a.Conduct a Public Hearing/Consider/Discuss/Action on an Ordinance amending the Planned Development (Ord. No. 792-2018) for Lakeview Estates Phase 3, Block B, Lot 17(PD 24-0003). (Director of Development Services Stephanie Scott-Sims) The planned development ordinance limits the use of the property to a daycare use only and the applicant began constructing the building in 2024. The applicant is proposing to use the building for elementary school classes, which is not currently allowed under the ordinance. Therefore, the applicant is requesting to repeal and replace the planned development ordinance to also allow a school use. The Planning & Zoning Commission recommended approval (7-0) of the zoning amendment request at the November 4, 2024 Planning & Zoning Commission meeting. Mayor Cain opened the public hearing at 6:06 PM. There were no public comments. Mayor Cain closed the public hearing at 6:07 PM. MOTION: Council Member Herndon moved to approve. Deputy Mayor Pro Tem Baker seconded. Motion carried 6-0. Property rezoned under this ordinance is generally located on the east side of South Ferguson Parkway, 140± feet north of Elm Street) AN ORDINANCE OF THE CITY OF ANNA, TEXAS AMENDING THE CITY’S COMPREHENSIVE PLAN, ZONING MAP, AND ZONING ORDINANCE AND CHANGING THE ZONING OF CERTAIN PROPERTY AS DESCRIBED HEREIN; PROVIDING FOR SAVINGS, REPEALING AND SEVERABILITY CLAUSES; PROVIDING FOR AN EFFECTIVE DATE; PROVIDING FOR A PENALTY CLAUSE NOT TO EXCEED $2,000 OR THE HIGHEST PENALTY AMOUNT ALLOWED BY LAW, WHICHEVER IS LESS; AND, PROVIDING FOR THE PUBLICATION OF THE CAPTION HEREOF. b.Consider/Discuss/Action on a Resolution approving a Service Plan Agreement for municipal services for 62.4± acres on the north side of County Road 371, 1,100± feet west of Bryant Farm Road in accordance with the City Park Heights East Development Agreement (Res. No. 2024-04-1614). (ANX 24-0001) Planning Manager Lauren Mecke) Anna 60 Partners, L.P. has submitted a petition to annex 62.4± acres of land. The Service Plan Agreement is required by state law prior to approval of annexation. The annexation request is on this agenda. MOTION: Mayor Pro Tem Carver moved to approve. Council Member Toten seconded. Motion carried 6-0. A RESOLUTION ADOPTING A CONDITIONAL AGREEMENT REGARDING SERVICES RELATED TO ANNEXATION OF A 62.4± ACRE TRACT OF LAND c.Conduct a Public Hearing/Consider/Discuss/Action on an Ordinance to annex 62.4± acres on the north side of County Road 371, 1,100± feet west of Bryant Farm Road in accordance with the City Park Heights East Development Agreement (Res. No. 2024-04-1614). (ANX 24-0001) (Planning Manager Lauren Mecke) Anna 60 Partners, L.P. has submitted a petition to annex 62.4± acres of land in accordance with the Pre-Annexation Development Agreement (Res. No. 2024- 04- 1614). The request to enter into a Service Plan Agreement for the development is on this agenda. Mayor Cain opened the public hearing at 6:10 PM. There were no public comments. Mayor Cain closed the public hearing at 6:11 PM. MOTION: Council Member Toten moved to approve. Council Member Herndon seconded. Motion carried 6-0. AN ORDINANCE ANNEXING THE HEREINAFTER DESCRIBED TERRITORY TO THE CITY OF ANNA, COLLIN COUNTY, TEXAS, AND EXTENDING THE BOUNDARY LIMITS OF SAID MUNICIPALITY SO AS TO INCLUDE SAID HEREINAFTER DESCRIBED PROPERTY WITHIN SAID MUNICIPAL CORPORATE LIMITS AND GRANTING TO ALL THE INHABITANTS OF SAID PROPERTY ALL THE RIGHTS AND PRIVILEGES OF OTHER CITIZENS AND BINDING SAID INHABITANTS BY ALL OF THE ACTS, ORDINANCES, RESOLUTIONS, AND REGULATIONS OF SAID CITY AS SET FORTH HEREIN; PROVIDING A REPEALER CLAUSE; PROVIDING A SEVERABILITY CLAUSE; AND PROVIDING AN EFFECTIVE DATE. d.Conduct a Public Hearing/Consider/Discuss/Action on an Ordinance to zone 62.4± acres on the north side of County Road 371, 1,100± feet west of Bryant Farm Road to Planned Development in accordance with the City Park Heights East Development Agreement (Res. No. 2024-04-1614). (PD 24-0001) Planning Manager Lauren Mecke) The applicant is proposing 449 Mixed-Density (MD) lots (234 single-family detached dwellings and 215 single-family attached dwellings) lots with 11 Homeowners’ Association lots in accordance with a Pre-Annexation Development Agreement (Res No. 2024-04-1614). Mayor Cain opened the public hearing at 6:11 PM. There were no public comments. Mayor Cain closed the public hearing at 6:11 PM. Property rezoned under this ordinance is generally located on the north side of County Road 371, 1,100 feet west of Bryant Farm Road) AN ORDINANCE OF THE CITY OF ANNA, TEXAS AMENDING THE CITY’S COMPREHENSIVE PLAN, ZONING MAP, AND ZONING ORDINANCE AND CHANGING THE ZONING OF CERTAIN PROPERTY AS DESCRIBED HEREIN; PROVIDING FOR SAVINGS, REPEALING AND SEVERABILITY CLAUSES; PROVIDING FOR AN EFFECTIVE DATE; PROVIDING FOR A PENALTY CLAUSE NOT TO EXCEED $2,000 OR THE HIGHEST PENALTY AMOUNT ALLOWED BY LAW, WHICHEVER IS LESS; AND, PROVIDING FOR THE PUBLICATION OF THE CAPTION HEREOF. e.Consider/Discuss/Action on a Resolution approving an Agreement Regarding Services including a plan for municipal services for 202.3± acres of land located at the southwest corner of County Road 285 and County Road 827 in accordance with the City Park Heights West, Development Agreement (Res. No. 2024-04-1615) (ANX 24-0003). (Planning Manager Lauren Mecke) Anna 204 Partners, L.P. has submitted a petition to annex 204.3± acres of land. The Service Plan Agreement is required by state law prior to approval of annexation. The applicant’s annexation request and zoning request are on this agenda. MOTION: Council Member Herndon moved to approve. Council Member Toten seconded. Motion carried 6-0. A RESOLUTION ADOPTING A CONDITIONAL AGREEMENT REGARDING SERVICES RELATED TO ANNEXATION OF A 202.30± ACRE TRACT OF LAND f.Conduct a Public Hearing/Consider/Discuss/Action on an Ordinance to annex 202.3± acres of land located at the southwest corner of County Road 285 and County Road 827 in accordance with the City Park Heights West, Development Agreement (Res. No. 2024-04-1615) (ANX 24-0003). (Planning Manager Lauren Mecke) Anna 204 Partners, L.P. has submitted a petition to annex 202.3± acres of land in accordance with the Pre-Annexation Development Agreement (Res. No. 2024-04- 1615). The applicant’s request to enter into a Service Plan Agreement and zoning request are on this agenda Mayor Cain opened the public hearing at 6:14 PM. There were no public comments. Mayor Cain closed the public hearing at 6:14 PM. MOTION: Council Member Toten moved to approve. Council Member Herndon seconded. Motion carried 6-0. AN ORDINANCE ANNEXING THE HEREINAFTER DESCRIBED TERRITORY TO THE CITY OF ANNA, COLLIN COUNTY, TEXAS, AND EXTENDING THE BOUNDARY LIMITS OF SAID MUNICIPALITY SO AS TO INCLUDE SAID HEREINAFTER DESCRIBED PROPERTY WITHIN SAID MUNICIPAL CORPORATE LIMITS AND GRANTING TO ALL THE INHABITANTS OF SAID PROPERTY ALL THE RIGHTS AND PRIVILEGES OF OTHER CITIZENS AND BINDING SAID INHABITANTS BY ALL OF THE ACTS, ORDINANCES, RESOLUTIONS, AND REGULATIONS OF SAID CITY AS SET FORTH HEREIN; PROVIDING A REPEALER CLAUSE; PROVIDING A SEVERABILITY CLAUSE; AND PROVIDING AN EFFECTIVE DATE. g.Conduct a Public Hearing/Consider/Discuss/Action on an Ordinance to zone 202.3± acres of land located at the southwest corner of County Road 285 and County Road 827 to Planned Development in accordance with the City Park Heights West, Development Agreement (Res. No. 2024-04-1615). (PD 24- 0004) (Planning Manager Lauren Mecke) The applicant is proposing 432 single family detached dwellings, 275 single family attached dwellings, 58 Homeowners’ Association lots, two City parks, and a civic center (fire station) lot in accordance with the Pre-Annexation Development Agreement (Res. No. 2024-04-1615). Mayor Cain opened the public hearing at 6:15 PM. There were no public comments. Mayor Cain closed the public hearing at 6:15 PM. MOTION: Council Member Herndon moved to approve. Mayor Pro Tem Carver seconded. Motion carried 6-0. Property rezoned under this ordinance is generally located at the intersection of County Road 285 and County Road 827) AN ORDINANCE OF THE CITY OF ANNA, TEXAS AMENDING THE CITY’S COMPREHENSIVE PLAN, ZONING MAP, AND ZONING ORDINANCE AND CHANGING THE ZONING OF CERTAIN PROPERTY AS DESCRIBED HEREIN; PROVIDING FOR SAVINGS, REPEALING AND SEVERABILITY CLAUSES; PROVIDING FOR AN EFFECTIVE DATE; PROVIDING FOR A PENALTY CLAUSE NOT TO EXCEED $2,000 OR THE HIGHEST PENALTY AMOUNT ALLOWED BY LAW, WHICHEVER IS LESS; AND, PROVIDING FOR THE PUBLICATION OF THE CAPTION HEREOF. h.Consider/Discuss/Action on a Resolution approving a Development Agreement with Tellus Texas III, LLC, a Texas limited liability company and its successors and assigns, and Sherley Partners, LTD. (Director of Economic Development Bernie Parker) Over the past few months, staff has been working with the Tellus Group and our financial consultants and legal counsel to develop a Development Agreement. Staff recommends approval. MOTION: Mayor Pro Tem Carver moved to approve. Council Member Toten seconded. Motion carried 6-0. A RESOLUTION OF THE CITY OF ANNA, TEXAS APPROVING THE SHERLEY FARMS DEVELOPMENT AGREEMENT WITH TELLUS TEXAS III, LLC AND SHERLEY PARTNERS, LTD, RELATING TO DEVELOPMENT OF PROPERTY FOR A MIXED USE DEVELOPMENT i.Acting as the Anna Public Facility Corporation Board of Directors, Consider/Discuss/Action on a resolution authorizing and approving final transaction and financing documents in connection with the acquisition, financing and construction of the “Anna Apartments” to be located at 900 S Buddy Hayes Blvd in the City of Anna, Texas. (Director of Economic Development Bernie Parker) MOTION: Council Member Herndon moved to take no action. Deputy Mayor Pro Tem Baker seconded. Motion carried 6-0. j.Acting as the Anna Housing Financial CorportationCorporation Board of Directors, Consider/Discuss/Action upon resolutions authorizing and approving final transaction documents in connection with the issuance of the Collin County Housing Finance Corporation Multifamily Housing Revenue Note Parmore Anna) Series 2025 and permanent loan financing to refund the existing governmental note and refinance the construction debt for the Parmore Anna” multifamily residential development, and related transactions. Director of Economic Development Bernie Parker) MOTION: Deputy Mayor Pro Tem Baker moved to take no action. Council Member Herndon seconded. Motion carried 6-0. k.Consider/Discuss/Action on a Resolution authorizing the City Manager to execute a Wholesale Wastewater Contract by and between the City of Anna, Texas and the City of Van Alstyne, Texas. (Assistant City Manager Greg Peters, P.E.) This item is to authorize the execution of a contract with the City of Van Alstyne for wastewater transport through the City of Anna wastewater system and wastewater treatment at the Hurricane Creek Regional Wastewater Treatment Plant. MOTION: Mayor Pro Tem Carver moved to approve. Council Member Toten seconded. Motion carried 6-0. A RESOLUTION OF THE CITY OF ANNA, TEXAS AUTHORIZING THE CITY MANAGER TO EXECUTE A WHOLESALE WASTEWATER CONTRACT BETWEEN THE CITY OF ANNA AND THE CITY OF VAN ALSTYNE, FOR WASTEWATER TREATMENT AND TRANSPORT, SUBJECT TO APPROVAL AS TO LEGAL FORM BY THE CITY ATTORNEY, WITH AN EFFECTIVE DATE. l.Consider/Discuss/Action on the TCAP Election Ballot for 2025-2026 Board of Directors. (City Manager Ryan Henderson) The ballot for the election of eight members to the TCAP Board of Directors for the 2025-2026 term of office was presented. Nine individuals have volunteered to become candidates for the TCAP Board of Directors, and their brief biographies are included in the PDF file. MOTION: Mayor Cain moved to vote for Chuong Phung, Aimee Rae Ferguson, Clifford Howard, Jo Ella Wagner,, Carey D. Neal, Jr., Clayton Fulton, Mark Poland, and Gilber P. Reyna Jr.. Council Member Herndon seconded. Motion carried 6-0. m.Consider/Discuss/Action on appointment to the Neighbor Engagement and Inclusion Advisory Commission to fill a vacancy. (Interview Committee) This item is to fill a vacancy in Place 7 on the Neighbor Engagement and Inclusion Advisory Commission. The Interview Committee has nominated Theresa King-Bell. MOTION: Council Member Herndon moved to appoint Theresa King- Bell. Deputy Mayor Pro Tem Baker seconded. Motion carried 6-0. 7.Closed Session (Exceptions). Under Tex. Gov't Code Chapter 551, the City Council may enter into Closed Session to discuss any items listed or referenced on this Agenda under the following exceptions: a.Consult with legal counsel regarding pending or contemplated litigation and/or on matters in which the duty of the attorney to the governmental body under the Texas Disciplinary Rules of Professional Conduct of the State Bar of Texas clearly conflicts with Chapter 551 of the Government Code (Tex. Gov’t Code 551.071). b.Discuss or deliberate the purchase, exchange, lease, or value of real property Tex. Gov’t Code §551.072). c.Discuss or deliberate Economic Development Negotiations: (1) To discuss or deliberate regarding commercial or financial information that the City has received from a business prospect that the City seeks to have locate, stay, or expand in or near the territory of the City of Anna and with which the City is conducting economic development negotiations; or (2) To deliberate the offer of a financial or other incentive to a business prospect described by subdivision 1). (Tex. Gov’t Code §551.087). d.Discuss or deliberate personnel matters (Tex. Gov’t Code §551.074). Boards and Commission. City Council. MOTION: Council Member Toten moved to enter closed session. Council Member Herndon seconded. Motion carried 6-0. Mayor Cain recessed the meeting at 6:34 PM. Mayor Cain reconvened the meeting at 7:15 PM. The Council further reserves the right to enter into Executive Session at any time throughout any duly noticed meeting under any applicable exception to the Open Meetings Act. 8.Consider/Discuss/Action on any items listed on any agenda - work session, regular meeting, or closed session - that is duly posted by the City of Anna for any City Council meeting occurring on the same date as the meeting noticed in this agenda. 9.Adjourn. Mayor Cain adjourned the meeting at 7:15 PM. APPROVED this _____ day of _____________, 2024 Mayor Pete Cain ATTEST: City Secretary Carrie L. Land Item No. 6.b. City Council Agenda Staff Report Meeting Date: 1/14/2025 Staff Contact: Bernie Parker AGENDA ITEM: Review Minutes of the December 5, 2024, Joint Community Development Corporation and Economic Development Corporation Board Meeting. (Director of Economic Development Bernie Parker) SUMMARY: This item is for Council to review meeting minutes from the November 7, 2024, CDC/EDC Joint Board Meeting. FINANCIAL IMPACT: This item has no financial impact. BACKGROUND: The CDC/EDC Board met on December 5, 2024, for their monthly Joint Board Meeting. STRATEGIC CONNECTIONS: This item supports the City of Anna Strategic Plan, specifically advancing the strategic outcome area: Excellent. ATTACHMENTS: 1. December 5_2024 CDC EDC Joint Meeting Minutes (Signed) Item No. 6.c. City Council Agenda Staff Report Meeting Date: 1/14/2025 Staff Contact: Bernie Parker AGENDA ITEM: Approve a Resolution setting a Public Hearing under Sections 372.009 and 372.011 of the Texas Local Government Code on the Advisability of the Dissolution of the Crystal Park Public Improvement District within the Corporate Limits and extraterritorial jurisdiction of the City of Anna, Texas; and Authorizing the Issuance of Notice by the City Secretary of Anna, Texas regarding the Public Hearing. (Director Economic Development Bernie Parker) SUMMARY: Staff recommends approving a Resolution setting a Public Hearing under Sections 372.009 and 372.011 of the Texas Local Government Code on the Advisability of the Dissolution of the Crystal Park Public Improvement District within the Corporate Limits and extraterritorial jurisdiction of the City of Anna, Texas; and Authorizing the Issuance of Notice by the City Secretary of Anna, Texas regarding the Public Hearing. FINANCIAL IMPACT: Not Applicable BACKGROUND: At the request of Bloomfield Homes, the City Council created the Crystal Park PID in 2023. Due to a technical error in the petition that was submitted by Bloomfield Homes at that time, the Office of the Attorney General would likely not allow the existing Crystal Park PID to finance water and wastewater infrastructure, which infrastructure costs comprise the majority of the public improvements for which the District was created. Upon consultation with Bond Counsel, the simplest way to remedy this situation is to dissolve the original Crystal Park PID and create a new PID to be named Crystal Park PID No. 2, which will be empowered to finance water and wastewater infrastructure. This dissolution and re-creation process will require four separate meetings and two public hearings, which will take place during the four regular City Council meetings scheduled for January and February 2025. These procedural steps are not substantive and are ministerial in nature, and Bond Counsel recommends the two resolutions in January be placed on the consent agendas for those two meetings. STRATEGIC CONNECTIONS: Goal 1: Sustainable Anna Community Through Planned Managed Growth ATTACHMENTS: 1. Resolution Setting Dissolution Hearing Crystal Park PID v2 CERTIFICATE FOR RESOLUTION We, the undersigned officers of the City of Anna, Texas, hereby certify as follows: 1. The City Council of said City convened in Regular Session on the 11th day of June, 2024, at the scheduled meeting place thereof, and the roll was called of the duly constituted officers and members of said City Council, to-wit: Pete Cain, Mayor Lee Miller, Council Member Stan Carver II, Mayor Pro Tem Jody Bills, Council Member Elden Baker, Deputy Mayor Pro-Tem Randy Atchley, Council Member Kevin Toten, Council Member Ryan Henderson, City Manager Carrie Land, City Secretary and all of said persons were present, except constituting a quorum. Whereupon, among other business, the following was transacted at said meeting: a written Resolution A RESOLUTION SETTING A PUBLIC HEARING UNDER SECTIONS 372.009 AND 372.011 OF THE TEXAS LOCAL GOVERNMENT CODE ON THE ADVISABILITY OF THE DISSOLUTION OF THE CRYSTAL PARK PUBLIC IMPROVEMENT DISTRICT WITHIN THE CORPORATE LIMITS AND EXTRATERRITORIAL JURISDICTION OF THE CITY OF ANNA, TEXAS; AND AUTHORIZING THE ISSUANCE OF NOTICE BY THE CITY SECRETARY OF ANNA, TEXAS REGARDING THE PUBLIC HEARING. was duly introduced for consideration and passage. It was then duly moved and seconded that said Resolution be passed; and, after due discussion, said motion, carrying with it the passage of said Resolution, prevailed and carried by the following vote: AYES: NOES: ABSTENTIONS: 2. A true, full and correct copy of the aforesaid Resolution passed at the meeting described in the above and foregoing paragraph is attached to and follows this Certificate; said Resolution has been duly recorded in the official minutes of said City Council; the above and foregoing paragraph is a true and correct excerpt from said minutes of said meeting pertaining to the passage of said Resolution; the persons named in the above and foregoing paragraph, at the time of said meeting and the passage of said Resolution, were the duly chosen, qualified and acting members of said City Council as indicated therein; each of said officers and member was duly and sufficiently notified officially and personally in advance, of the time, place and purpose of the aforesaid meeting and that said Resolution would be introduced and considered for passage at said meeting; and said meeting was open to the public, and public notice of the time, place and purpose of said meeting was given, all as required by Chapter 551, Texas Government Code. 3. That the Mayor of said City has approved and hereby approves the aforesaid Resolution; that the Mayor and the City Secretary of said City have duly signed said Resolution; and that the Mayor and the City Secretary of said City hereby declare that their signing of this Certificate shall constitute the signing of the attached and following copy of said Resolution for all purposes. SIGNED AND SEALED THE 14TH DAY OF JANUARY, 2025. ATTEST: ___________________________________ PeteCain, Mayor Carrie L. Land, City Secretary SEAL) 1 CITY OF ANNA, TEXAS RESOLUTION NO. 2025-01-___ A RESOLUTION SETTING A PUBLIC HEARING UNDER SECTIONS 372.009 AND 372.011 OF THE TEXAS LOCAL GOVERNMENT CODE ON THE ADVISABILITY OF THE DISSOLUTION OF THE CRYSTAL PARK PUBLIC IMPROVEMENT DISTRICT WITHIN THE CORPORATE LIMITS AND EXTRATERRITORIAL JURISDICTION OF THE CITY OF ANNA, TEXAS; AND AUTHORIZING THE ISSUANCE OF NOTICE BY THE CITY SECRETARY OF ANNA, TEXAS REGARDING THE PUBLIC HEARING. WHEREAS, the City of Anna, Texas (the “City”), is authorized under Chapter 372 of the Texas Local Government Code (the “Act”), to create a public improvement district within its corporate limits and its extraterritorial jurisdiction; and WHEREAS, on April 12, 2022, the City Council of the City (the “City Council”), after public hearing, authorized the creation of the Crystal Park Public Improvement District (the District”) pursuant to Resolution No. 2022-04-1139, which District is described by metes and bounds and depicted on Exhibit A, and which Resolution inadvertently omitted water and wastewater facilities within the list of “Authorized Improvements” to be financed by the District; and WHEREAS, on December 10, 2024, Bloomfield Homes, L.P. a Texas limited partnership the “Petitioner”), being the owner of (1) taxable real property representing more than 50 percent of the appraised value of taxable real property liable for assessment under the proposal, as determined by the current roll of the appraisal district in which the property is located and (2) record owner of real property liable for assessment under the proposal who: (A) constitutes more than 50 percent of all record owners of property that is liable for assessment under the proposal; or (B) owns taxable real property that constitutes more than 50 percent of the area of all taxable real property that is liable for assessment under the proposal, submitted and filed with the City Secretary of Anna (the “City Secretary”) a certain Petition for the Dissolution of the Crystal Park Public Improvement District Petition”), attached as Exhibit A, requesting the dissolution of the District; and WHEREAS, the Act further requires that prior to the adoption of the resolution dissolving the District, the City Council must hold a public hearing on the advisability of dissolving the District in the same manner as a public hearing under Section 372.009 of the Act; and WHEREAS, it is hereby officially found and determined that the meeting at which this resolution was considered was open to the public, and public notice of the time, place and purpose of said meeting was given, all as required by Chapter 551, Texas Government Code; and WHEREAS, in order to hold a public hearing for the dissolution of a public improvement district, notice must be given in a newspaper of general circulation in the municipality before the 15th day before the date of the hearing, and written notice must be mailed to the current address of each 2 owner, as reflected on the tax rolls, of property that would be subject to assessment under the proposed public improvement district; and WHEREAS, both newspaper notice and mailed notice must contain the information required for notice as provided for in Section 372.009 of the Act; and WHEREAS, the City Council has determined to hold a public hearing on February 11, 2025 on the dissolution of the District; and WHEREAS, the City Council finds that the passage of this Resolution is in the best interest of the citizens of the City. NOW, THEREFORE, BE IT RESOLVED BY THE CITY COUNCIL OF THE CITY OF ANNA, TEXAS: Section 1: All of the above recitals are hereby found to be true and correct factual determinations of the City and are hereby approved and incorporated by reference as though fully set forth herein. Section 2: City Staff reviewed the Petition and determined that the same complied with the requirements of the Act and the City Council accepts the Petition. Section 3: That a public hearing is hereby called for February 11, 2025, at 6:00 p.m. at the Anna City Hall, Council Chambers, 120 W. 7th Street,, Anna, Texas 75409, for the purpose of hearing public testimony with respect to the advisability of dissolving the District. Section 4: At such time and place the City Council will hear testimony regarding the dissolution of the District and the City Council may, within its sole discretion, consider the adoption of a resolution dissolving the District. Section 5: Attached hereto as Exhibit A is the Petition for the Dissolution of the Crystal Park Public Improvement District, which includes a metes and bounds legal description of the approximately 360.452 acres of property comprising the District. Section 6: Attached hereto as Exhibit B is a form of the Notice of Public Hearing (the Notice”) the form and substance of which is hereby adopted and approved. Section 7: The City Secretary is hereby authorized and directed to cause said Notice to be published in substantially the form attached hereto, in a newspaper of general circulation in the City where the District is located, and to mail a copy of said Notice to all landowners within the boundaries of the District as required by law. The City Secretary shall provide Notice on or before January 26, 2025, which is before the 15th day before the February 11, 2025 hearing. Section 8: If any portion of this resolution shall, for any reason, be declared invalid by any court of competent jurisdiction, such invalidity shall not affect the remaining provisions hereof and 3 the City Council hereby determines that it would have adopted this resolution without the invalid provision. Section 9: This resolution shall be in full force and effect from and after its passage, and it is accordingly so resolved. PASSED AND APPROVED ON THIS 14TH DAY OF JANUARY, 2025. ATTEST: APPROVED: Carrie Land, City Secretary Pete Cain, Mayor EXHIBIT A Petition for the Dissolution of the District, including a Metes and Bounds Legal Description of the Crystal Park Public Improvement District 1 PETITION FOR THE DISSOLUTION OF THE CRYSTAL PARK PUBLIC IMPROVEMENT DISTRICT This petition (the “Petition”) is submitted and filed with the City Secretary of the City of Anna, Texas (the “City”), by Bloomfield Homes, L.P., a Texas limited partnership (the “Owner”), acting pursuant to the provisions of Chapter 372, Texas Local Government Code, as amended (the Act”), hereby requesting that the City conduct a public hearing regarding this Petition, pursuant to Section 372.011 of the Act, to consider dissolving the Crystal Park Public Improvement District the “District”). In support of this Petition, the Owner presents the following: I. The District was created by Resolution No. 2022-04-1139 adopted by the City Council of the City on April 12, 2022. The property comprising the District (the “Property”) is more particularly described in Exhibit A of which is attached hereto and are incorporated by reference herein. II. The purposes of the District include the design, acquisition, construction, and improvement of public improvement projects authorized by Section 372.003(b) of the Act that are necessary for the development of the property within the District, which public improvements may include: (i) street, roadway and sidewalk improvements, including related drainage, utility relocation, signalization, landscaping, lighting, signage, off-street parking and right-of-way; (ii) drainage improvements and facilities; (iii) parks, trails and recreational facilities improvements; (iv) projects similar to those listed above authorized by the Act, including similar off-site projects that provide a benefit to the Property within the District; (v) acquisition of real property, interests in real property, or contract rights in connection with each Authorized Improvement; (vi) payment of costs, including, without limitation, design, engineering, permitting, legal, required payment, performance and maintenance bonds, bidding, support, construction, construction management, administrative and inspection costs, associated with developing and financing the public improvements listed in (i) through (v) above; (vii) payment of costs associated with operating and maintaining the public improvements listed in (i) through (v) above; (viii) payment of costs of establishing, administering, and operating the District, as well as the interest, costs of issuance, reserve funds, or credit enhancement of bonds issued for the purposes described in (i) through viii) above (collectively, the “Authorized Improvements”). These Authorized Improvements shall promote the interests of the City and confer a special benefit upon the Property within the District. III. The estimated cost to design, acquire, and construct the Authorized Improvements, together with bond issuance costs (including but not limited to the funding of any capitalized interest and reserve funds), eligible legal and financial fees, eligible credit enhancement costs and eligible costs incurred in the establishment administration and operation of the District, is 50,000,000.00. The City will pay none of the costs of the proposed improvements from funds other than such assessments. The remaining costs of the proposed improvements will be paid from sources other than the City or assessments of property owners. 141175718v.1 2 IV. As of the date of this Petition, the Authorized Improvements have not been completed and the purposes for which the District was created have been frustrated. V. This Petition has been signed by (1) the owners of taxable real property representing more than 50 percent of the appraised value of taxable real property liable for assessment under the proposal, as determined by the current roll of the appraisal district in which the property is located; and (2) record owners of real property liable for assessment under the proposal who: (A) constitute more than 50 percent of all record owners of property that is liable for assessment under the proposal; or (B) own taxable real property that constitutes more than 50 percent of the area of all taxable real property that is liable for assessment under the proposal. Signature page follows] 1 EXHIBIT A LEGAL DESCRIPTION BEING A 390.452 ACRE TRACT OF LAND SITUATED IN THE R. JOHNSON SURVEY, ABSTRACT NO. 479, THE W. KITCHINGS SURVEY, ABSTRACT NO. 504, THE T. RATTAN SURVEY, ABSTRACT NO. 782, THE J. CAHILL SURVEY, ABSTRACT NO. 144, THE H. CHENAWETH SURVEY, ABSTRACT NO. 158, THE J. COFFMAN SURVEY, ABSTRACT NO. 197, THE J. ELLETT SURVEY, ABSTRACT NO. 295 AND THE J. KINCADE SURVEY, ABSTRACT NO. 510, CITY OF ANNA, COLLIN COUNTY, TEXAS, AND BEING PART OF A 148.68 ACRE TRACT OF LAND, CONVEYED TO F.A. MILLER, AS RECORDED IN COUNTY CLERK’S FILE NO. 19960321000231110, OFFICIAL PUBLIC RECORDS, COLLIN COUNTY, TEXAS, A 244.135 ACRE TRACT OF LAND CONVEYED TO FREDERICK ALEXANDER MILLER (18.6%), VIRGIL WREN MILLER (18.6%), MAQUIN JAN KUNKLE (18.6%), JEFFEREY WAYNE ROLLINS (22.1%), AND REBECCA LORRAINE BONA (22.1%), AS RECORDED IN VOLUME 5086, PAGE 1760, OFFICIAL PUBLIC RECORDS, COLLIN COUNTY, TEXAS. SAID 390.452 ACRE TRACT, WITH BEARING BASIS BEING GRID NORTH, TEXAS STATE PLANE COORDINATES, NORTH CENTRAL ZONE NAD83, (NAD83 (2011) EPOCH 2010), DETERMINED BY GPS OBSERVATIONS, CALCULATED FROM COLLIN CORS ARP PID-DF8982), AND DENTON CORS ARP (PID-DF8986), AND BEING MORE PARTICULARLY DESCRIBED BY METES AND BOUNDS AS FOLLOWS: BEGINNING AT A TxDOT HIGHWAY MONUMENT WITH ALUMINUM DISC FOUND FOR THE SOUTHEAST CORNER OF SAID 148.68 ACRE TRACT AND THE COMMON NORTHEAST CORNER OF COFFMAN CEMETERY, (NO RECORD DOCUMENT FOUND). SAID POINT BEING ON THE WEST RIGHT-OF-WAY LINE OF U.S. HIGHWAY NO. 75, (A VARIABLE WIDTH RIGHT-OF-WAY); THENCE, ALONG THE COMMON LINES OF SAID 148.68 ACRE TRACT AND SAID COFFMAN CEMETERY, THE FOLLOWING COURSES AND DISTANCES: NORTH 89 DEGREES 48 MINUTES 27 SECONDS WEST, A DISTANCE OF 322.00 FEET TO A 5/8" IRON ROD WITH YELLOW PLASTIC CAP STAMPED "LJA SURVEYING" SET FOR AN INTERIOR ELL CORNER OF SAID 148.68 ACRE TRACT AND THE COMMON NORTHWEST CORNER OF SAID CEMETERY; SOUTH 01 DEGREE 32 MINUTES 33 SECONDS WEST, A DISTANCE OF 93.00 FEET TO A 5/8" IRON ROD WITH YELLOW PLASTIC CAP STAMPED "LJA SURVEYING" SET FOR AN EXTERIOR ELL CORNER OF SAID 148.68 ACRE TRACT. SAID POINT BEING ON THE NORTH LINE OF A 97.682 ACRE TRACT OF LAND CONVEYED TO RATTAN PROPERTIES, LTD., AS RECORDED IN VOLUME 4820, PAGE 2729, OFFICIAL PUBLIC RECORDS, COLLIN COUNTY, TEXAS AND BEING WITHIN COUNTY ROAD NO. 284, A PRESCRIPTIVE RIGHT-OF-WAY, BY USE AND OCCUPATION); THENCE, NORTH 88 DEGREES 35 MINUTES 24 SECONDS WEST, ALONG THE SOUTH LINE OF SAID 148.68 ACRE TRACT AND THE COMMON NORTH LINE OF SAID 97.682 ACRE TRACT, WITH SAID COUNTY ROAD NO. 284, A DISTANCE OF 1509.22 FEET TO A 1/2" IRON 2 ROD FOUND FOR AN EXTERIOR ELL CORNER OF SAID 148.68 ACRE TRACT AND THE COMMON SOUTHEAST CORNER OF A TRACT OF LAND CONVEYED TO JOHN RATTAN AND SUE RATTAN, (NO RECORD DOCUMENT FOUND); THENCE, ALONG THE COMMON LINES OF SAID 148.68 ACRE TRACT AND SAID RATTAN TRACT, THE FOLLOWING COURSES AND DISTANCES: NORTH 18 DEGREES 15 MINUTES 04 SECONDS EAST, A DISTANCE OF 800.08 FEET TO A 1/2" IRON ROD FOUND FOR AN INTERIOR ELL CORNER OF SAID 148.68 ACRE TRACT AND THE COMMON NORTHEAST CORNER OF SAID RATTAN TRACT; NORTH 78 DEGREES 24 MINUTES 56 SECONDS WEST, A DISTANCE OF 700.67 FEET TO A 5/8" IRON ROD WITH YELLOW PLASTIC CAP STAMPED "LJA SURVEYING" SET FOR AN EXTERIOR ELL CORNER OF SAID 148.68 ACRE TRACT AND THE COMMON NORTHWEST CORNER OF SAID RATTAN TRACT. SAID POINT BEING ON THE EAST LINE OF AFORESAID 244.135 ACRE TRACT AND BEING WITHIN COUNTY ROAD NO. 286, (A PRESCRIPTIVE RIGHT-OF-WAY, BY USE AND OCCUPATION); THENCE, ALONG SAID COMMON LINES OF SAID 244.135 ACRE TRACT AND THE WEST LINE OF A SAID RATTAN TRACT, THE FOLLOWING COURSES AND DISTANCES: SOUTH 02 DEGREES 45 MINUTES 42 SECONDS EAST, A DISTANCE OF 22.19 FEET TO A 5/8" IRON ROD WITH YELLOW PLASTIC CAP STAMPED "LJA SURVEYING" SET FOR CORNER; SOUTH 04 DEGREES 42 MINUTES 42 SECONDS WEST, A DISTANCE OF 362.07 FEET TO A 5/8" IRON ROD WITH YELLOW PLASTIC CAP STAMPED "LJA SURVEYING" SET FOR CORNER; SOUTH 05 DEGREES 43 MINUTES 05 SECONDS WEST, A DISTANCE OF 496.57 FEET TO A 5/8" IRON ROD WITH YELLOW PLASTIC CAP STAMPED "LJA SURVEYING" SET FOR THE SOUTHWEST CORNER OF SAID RATTAN TRACT AND A COMMON NORTHWEST CORNER OF A 97.682 ACRE TRACT OF LAND CONVEYED TO RATTAN PROPERTIES, LTD, AS RECORDED IN VOLUME 4820, PAGE 2729, OFFICIAL PUBLIC RECORDS, COLLIN COUNTY, TEXAS; THENCE, SOUTH 01 DEGREE 13 MINUTES 34 SECONDS WEST, ALONG THE EAST LINE OF SAID 244.135 ACRE TRACT AND THE COMMON WEST LINE OF SAID 97.682 ACRE TRACT, WITH SAID COUNTY ROAD NO. 286, A DISTANCE OF 484.11 FEET TO A 5/8" IRON ROD WITH YELLOW PLASTIC CAP STAMPED "LJA SURVEYING" SET FOR THE SOUTHEAST CORNER OF SAID 244.135 ACRE TRACT AND THE COMMON NORTHEAST CORNER OF A 140.00 ACRE TRACT OF LAND CONVEYED TO JOHN ANDREW ADAMS AND LESLIE JANE BOX, AS RECORDED IN VOLUME 5389, PAGE 3671, OFFICIAL PUBLIC RECORDS, COLLIN COUNTY, TEXAS; 3 THENCE, SOUTH 87 DEGREES 14 MINUTES 28 SECONDS WEST, ALONG THE SOUTH LINE OF SAID 244.135 ACRE TRACT AND THE COMMON NORTH LINE OF SAID 140.00 ACRE TRACT, A DISTANCE OF 3215.64 FEET TO A 60D NAIL FOUND FOR THE SOUTHWEST CORNER OF SAID 244.135 ACRE TRACT AND A COMMON EXTERIOR ELL CORNER OF SAID 140.00 ACRE TRACT. SAID POINT BEING ON THE EAST LINE OF A 216.801 ACRE TRACT OF LAND CONVEYED TO VERLA SUE HOLLAND AND MAURINE DICKEY, AS RECORDED IN COUNTY CLERK’S FILE NO. 95-0011069, OFFICIAL PUBLIC RECORDS, COLLIN COUNTY, TEXAS; THENCE, ALONG THE COMMON LINES OF SAID 244.135 ACRE TRACT AND THE SAID 216.801 ACRE TRACT, THE FOLLOWING COURSES AND DISTANCES: NORTH 02 DEGREES 16 MINUTES 14 SECONDS EAST, A DISTANCE OF 119.99 FEET TO A 5/8" IRON ROD WITH YELLOW PLASTIC CAP STAMPED "LJA SURVEYING" SET FOR CORNER; NORTH 00 DEGREES 42 MINUTES 51 SECONDS WEST, A DISTANCE OF 640.05 FEET TO A 5/8" IRON ROD WITH YELLOW PLASTIC CAP STAMPED "LJA SURVEYING" SET FOR CORNER; NORTH 00 DEGREES 45 MINUTES 11 SECONDS WEST, A DISTANCE OF 357.30 FEET TO A 5/8" IRON ROD WITH YELLOW PLASTIC CAP STAMPED "LJA SURVEYING" SET FOR CORNER; NORTH 01 DEGREE 39 MINUTES 21 SECONDS WEST, A DISTANCE OF 381.16 FEET TO A 1/2" IRON ROD FOUND FOR AN INTERIOR ELL CORNER, OF SAID 244.135 ACRE TRACT AND THE COMMON NORTHEAST CORNER OF SAID 216.801 ACRE TRACT. SAID POINT BEING AT THE END OF AFORESAID COUNTY ROAD NO. 937; NORTH 87 DEGREES 21 MINUTES 39 SECONDS WEST, A DISTANCE OF 29.55 FEET TO A 60D NAIL FOUND FOR AN EXTERIOR ELL CORNER OF SAID 244.135 ACRE TRACT AND THE COMMON SOUTHEAST CORNER OF A 245.6 ACRE TRACT OF LAND CONVEYED TO VIRGIL WREN MILLER, AS RECORDED IN VOLUME 5823, PAGE 3619, OFFICIAL PUBLIC RECORDS, COLLIN COUNTY, TEXAS; THENCE, ALONG THE WEST LINE OF SAID 244.135 ACRE TRACT AND THE COMMON EAST LINE OF SAID 245.6 ACRE TRACT, WITH SAID COUNTY ROAD NO. 937, THE FOLLOWING COURSES AND DISTANCES: NORTH 12 DEGREES 06 MINUTES 31 SECONDS WEST, A DISTANCE OF 109.36 FEET TO A 5/8" IRON ROD WITH YELLOW PLASTIC CAP STAMPED "LJA SURVEYING" SET FOR CORNER; NORTH 06 DEGREES 52 MINUTES 41 SECONDS WEST, A DISTANCE OF 258.10 FEET TO A 5/8" IRON ROD WITH YELLOW PLASTIC CAP STAMPED "LJA SURVEYING" SET FOR CORNER; 4 NORTH 09 DEGREES 46 MINUTES 25 SECONDS WEST, A DISTANCE OF 725.61 FEET TO A 60D NAIL FOUND FOR CORNER; NORTH 28 DEGREES 35 MINUTES 06 SECONDS WEST, A DISTANCE OF 186.41 FEET TO A 5/8" IRON ROD WITH YELLOW PLASTIC CAP STAMPED "LJA SURVEYING" SET FOR CORNER; NORTH 14 DEGREES 05 MINUTES 23 SECONDS WEST, A DISTANCE OF 170.86 FEET TO A 60D NAIL FOUND FOR CORNER; NORTH 00 DEGREES 03 MINUTES 33 SECONDS EAST, A DISTANCE OF 250.08 FEET TO A 60D NAIL FOUND (BENT) FOR CORNER; NORTH 02 DEGREES 44 MINUTES 20 SECONDS EAST, PASSING THE NORTH LINE OF SAID 245.6 ACRE TRACT AND THE COMMON SOUTH LINE OF AFORESAID 64 ACRE TRACT, AND CONTINUING ALONG THE WEST LINE OF SAID 244.135 ACRE TRACT AND THE COMMON EAST LINE OF SAID 64 ACRE TRACT, IN ALL, A TOTAL DISTANCE OF 254.07 FEET TO A 5/8" IRON ROD WITH YELLOW PLASTIC CAP STAMPED "LJA SURVEYING" SET FOR CORNER; THENCE, NORTH 03 DEGREES 55 MINUTES 14 SECONDS EAST, CONTINUING ALONG SAID COMMON LINE, WITH SAID COUNTY ROAD NO. 937, A DISTANCE OF 923.21 FEET A 1/2" IRON FOUND FOR THE NORTH CORNER OF SAID 244.135 ACRE TRACT AND THE COMMON SOUTHWEST CORNER OF A 5.765 ACRE TRACT OF LAND CONVEYED TO SUNLIT HOLDING, LLC, AS RECORDED IN COUNTY CLERK’S FILE NO. 20190221000181710, OFFICIAL PUBLIC RECORDS, COLLIN COUNTY, TEXAS. SAID POINT BEING ON THE EAST LINE OF A 64 ACRE TRACT OF LAND CONVEYED TO NAOMI L. WATSON, AS RECORDED IN COUNTY CLERK’S FILE NO. 20140313000236380, OFFICIAL PUBLIC RECORDS, COLLIN COUNTY, TEXAS AND BEING WITHIN THE APPROXIMATE CENTER OF COUNTY ROAD NO. 937, (A PRESCRIPTIVE RIGHT-OF-WAY BY USE AND OCCUPATION), FROM WHICH A 1/2" IRON ROD WITH CAP STAMPED PEISER.MANKIN.SUR” FOUND FOR THE NORTHWEST CORNER OF SAID 5.765 ACRE TRACT AND A COMMON SOUTHWEST CORNER OF A 101.118 ACRE TRACT OF LAND CONVEYED AS “TRACT 1” TO SUNLIT HOLDING, LLC, AS RECORDED IN COUNTY CLERK’S FILE NO. 20180925001201240, OFFICIAL PUBLIC RECORDS, COLLIN COUNTY, TEXAS, BEARS NORTH 03 DEGREES 55 MINUTES 14 SECONDS EAST, A DISTANCE OF 50.00 FEET; THENCE, ALONG THE NORTHEAST LINE OF SAID 244.135 ACRE TRACT AND THE COMMON SOUTHWEST LINE OF SAID 5.765 ACRE TRACT, THE FOLLOWING COURSES AND DISTANCES: SOUTH 48 DEGREES 26 MINUTES 03 SECONDS EAST, A DISTANCE OF 82.66 FEET TO A 5/8" IRON ROD WITH YELLOW PLASTIC CAP STAMPED "LJA SURVEYING" SET FOR CORNER; 5 SOUTH 67 DEGREES 30 MINUTES 05 SECONDS EAST, A DISTANCE OF 84.40 FEET TO 60D NAIL FOUND FOR CORNER; SOUTH 62 DEGREES 35 MINUTES 14 SECONDS EAST, A DISTANCE OF 296.45 FEET TO A 60D NAIL FOUND FOR CORNER; SOUTH 41 DEGREES 10 MINUTES 03 SECONDS EAST, A DISTANCE OF 157.79 FEET TO A 5/8" IRON ROD WITH YELLOW PLASTIC CAP STAMPED "LJA SURVEYING" SET FOR CORNER; SOUTH 78 DEGREES 06 MINUTES 15 SECONDS EAST, A DISTANCE OF 262.41 FEET TO A 60D NAIL FOUND FOR CORNER; SOUTH 55 DEGREES 39 MINUTES 45 SECONDS EAST, A DISTANCE OF 144.29 FEET TO A 5/8" IRON ROD WITH YELLOW PLASTIC CAP STAMPED "LJA SURVEYING" SET FOR THE SOUTHEAST CORNER OF SAID 5.765 ACRE TRACT AND A COMMON EXTERIOR ELL CORNER OF AFORESAID 101.118 ACRE TRACT; THENCE, CONTINUING ALONG THE NORTHEAST LINE OF SAID 244.135 ACRE TRACT AND THE COMMON SOUTHWEST LINE OF SAID 101.118 ACRE TRACT, THE FOLLOWING COURSES AND DISTANCES: SOUTH 89 DEGREES 18 MINUTES 28 SECONDS EAST, A DISTANCE OF 348.05 FEET TO A 60D NAIL FOUND FOR CORNER; SOUTH 21 DEGREES 37 MINUTES 21 SECONDS EAST, A DISTANCE OF 346.53 FEET TO A 5/8" IRON ROD WITH YELLOW PLASTIC CAP STAMPED "LJA SURVEYING" SET FOR CORNER; SOUTH 06 DEGREES 07 MINUTES 23 SECONDS EAST, A DISTANCE OF 211.96 FEET TO A 5/8" IRON ROD WITH YELLOW PLASTIC CAP STAMPED "LJA SURVEYING" SET FOR CORNER; SOUTH 37 DEGREES 30 MINUTES 06 SECONDS EAST, A DISTANCE OF 88.02 FEET TO A 5/8" IRON ROD WITH YELLOW PLASTIC CAP STAMPED "LJA SURVEYING" SET FOR CORNER; SOUTH 64 DEGREES 23 MINUTES 44 SECONDS EAST, A DISTANCE OF 62.59 FEET TO A 60D NAIL FOUND FOR CORNER; SOUTH 42 DEGREES 35 MINUTES 09 SECONDS EAST, A DISTANCE OF 246.54 FEET TO A 5/8" IRON ROD WITH YELLOW PLASTIC CAP STAMPED "LJA SURVEYING" SET FOR CORNER; 6 SOUTH 88 DEGREES 51 MINUTES 58 SECONDS EAST, A DISTANCE OF 72.92 FEET TO A 5/8" IRON ROD WITH YELLOW PLASTIC CAP STAMPED "LJA SURVEYING" SET FOR CORNER; SOUTH 61 DEGREES 26 MINUTES 55 SECONDS EAST, A DISTANCE OF 164.75 FEET TO A 5/8" IRON ROD WITH YELLOW PLASTIC CAP STAMPED "LJA SURVEYING" SET FOR CORNER; SOUTH 69 DEGREES 36 MINUTES 03 SECONDS EAST, A DISTANCE OF 58.91 FEET TO A 5/8" IRON ROD WITH YELLOW PLASTIC CAP STAMPED "LJA SURVEYING" SET FOR CORNER; SOUTH 17 DEGREES 13 MINUTES 17 SECONDS EAST, A DISTANCE OF 15.78 FEET TO A 5/8" IRON ROD WITH YELLOW PLASTIC CAP STAMPED "LJA SURVEYING" SET FOR CORNER; SOUTH 06 DEGREES 10 MINUTES 57 SECONDS EAST, A DISTANCE OF 125.36 FEET TO A 5/8" IRON ROD WITH YELLOW PLASTIC CAP STAMPED "LJA SURVEYING" SET FOR CORNER; SOUTH 53 DEGREES 17 MINUTES 57 SECONDS EAST, A DISTANCE OF 61.31 FEET TO A 5/8" IRON ROD WITH YELLOW PLASTIC CAP STAMPED "LJA SURVEYING" SET FOR CORNER; SOUTH 78 DEGREES 59 MINUTES 39 SECONDS EAST, A DISTANCE OF 125.01 FEET TO A 5/8" IRON ROD WITH YELLOW PLASTIC CAP STAMPED "LJA SURVEYING" SET FOR CORNER; SOUTH 80 DEGREES 01 MINUTE 26 SECONDS EAST, A DISTANCE OF 234.63 FEET TO A 5/8" IRON ROD WITH YELLOW PLASTIC CAP STAMPED "LJA SURVEYING" SET FOR CORNER; SOUTH 78 DEGREES 24 MINUTES 21 SECONDS EAST, A DISTANCE OF 426.09 FEET TO A 5/8" IRON ROD WITH YELLOW PLASTIC CAP STAMPED "LJA SURVEYING" SET FOR CORNER; SOUTH 80 DEGREES 54 MINUTES 25 SECONDS EAST, A DISTANCE OF 239.90 FEET TO A 5/8" IRON ROD WITH YELLOW PLASTIC CAP STAMPED "LJA SURVEYING" SET FOR CORNER; SOUTH 77 DEGREES 43 MINUTES 11 SECONDS EAST, A DISTANCE OF 68.50 FEET TO A 5/8" IRON ROD WITH YELLOW PLASTIC CAP STAMPED "LJA SURVEYING" SET FOR CORNER; 7 SOUTH 71 DEGREES 14 MINUTES 49 SECONDS EAST, A DISTANCE OF 42.49 FEET TO A 5/8" IRON ROD WITH YELLOW PLASTIC CAP STAMPED "LJA SURVEYING" SET FOR CORNER; SOUTH 66 DEGREES 21 MINUTES 02 SECONDS EAST, A DISTANCE OF 67.58 FEET TO A 5/8" IRON ROD WITH YELLOW PLASTIC CAP STAMPED "LJA SURVEYING" SET FOR CORNER; SOUTH 55 DEGREES 56 MINUTES 20 SECONDS EAST, A DISTANCE OF 73.51 FEET TO A 1/2" IRON ROD FOUND FOR THE SOUTHEAST CORNER OF SAID 101.118 ACRE TRACT AND THE WEST CORNER OF AFORESAID 148.68 ACRE TRACT; THENCE, ALONG THE COMMON LINES OF SAID 148.68 ACRE TRACT AND SAID 101.118 ACRE TRACT, THE FOLLOWING COURSES AND DISTANCES: NORTH 35 DEGREES 12 MINUTES 23 SECONDS EAST, A DISTANCE OF 177.76 FEET TO A 1/2" IRON ROD FOUND FOR CORNER; NORTH 42 DEGREES 44 MINUTES 06 SECONDS WEST, A DISTANCE OF 131.40 FEET TO A 1/2" IRON ROD FOUND FOR CORNER; NORTH 19 DEGREES 54 MINUTES 38 SECONDS WEST, A DISTANCE OF 41.83 FEET TO A 5/8" IRON ROD WITH YELLOW PLASTIC CAP STAMPED "LJA SURVEYING" SET FOR CORNER; NORTH 03 DEGREES 33 MINUTES 44 SECONDS WEST, A DISTANCE OF 30.38 FEET TO A 5/8" IRON ROD WITH YELLOW PLASTIC CAP STAMPED "LJA SURVEYING" SET FOR CORNER; NORTH 23 DEGREES 14 MINUTES 16 SECONDS EAST, A DISTANCE OF 444.46 FEET TO A 5/8" IRON ROD WITH YELLOW PLASTIC CAP STAMPED "LJA SURVEYING" SET FOR CORNER; NORTH 24 DEGREES 17 MINUTES 36 SECONDS EAST, A DISTANCE OF 387.15 FEET TO A 5/8" IRON ROD WITH YELLOW PLASTIC CAP STAMPED "LJA SURVEYING" SET FOR CORNER; NORTH 25 DEGREES 22 MINUTES 03 SECONDS EAST, A DISTANCE OF 293.24 FEET TO A 5/8" IRON ROD WITH YELLOW PLASTIC CAP STAMPED "LJA SURVEYING" SET FOR CORNER; NORTH 24 DEGREES 23 MINUTES 10 SECONDS EAST, A DISTANCE OF 419.41 FEET TO A 5/8" IRON ROD WITH YELLOW PLASTIC CAP STAMPED "LJA SURVEYING" SET FOR THE NORTHWEST CORNER OF SAID 148.68 ACRE TRACT AND THE COMMON NORTHEAST CORNER OF SAID 101.118 ACRE TRACT. SAID POINT BEING ON THE SOUTH LINE OF A 41.531 ACRE TRACT OF LAND CONVEYED AS 8 TRACT NO. 2” TO WBK PARTNERS, LTD., AS RECORDED IN COUNTY CLERK’S FILE NO. 98-126145, OFFICIAL PUBLIC RECORDS, COLLIN COUNTY, TEXAS; THENCE, SOUTH 69 DEGREES 20 MINUTES 00 SECONDS EAST, ALONG THE NORTHEAST LINE OF SAID 148.68 ACRE TRACT AND THE COMMON SOUTHWEST LINE OF SAID 41.531 ACRE TRACT, A DISTANCE OF 1130.40 FEET TO A 5/8" IRON ROD WITH YELLOW PLASTIC CAP STAMPED "LJA SURVEYING" SET FOR AN EXTERIOR ELL CORNER OF SAID 148.68 ACRE TRACT AND THE COMMON NORTHWEST CORNER OF A 33 ACRE TRACT OF LAND CONVEYED TO MIXON REALITY CO., AS RECORDED IN COUNTY CLERK’S FILE NO. 20110407000364750, OFFICIAL PUBLIC RECORDS, COLLIN COUNTY, TEXAS. SAID POINT BEING IN THE APPROXIMATE CENTER LINE OF AFORESAID COUNTY ROAD NO. 286; THENCE, ALONG THE COMMON LINES OF SAID 148.68 ACRE TRACT AND SAID 33 ACRE TRACT, WITH SAID COUNTY ROAD NO. 286, THE FOLLOWING COURSES AND DISTANCES: SOUTH 32 DEGREES 23 MINUTES 30 SECONDS WEST, A DISTANCE OF 148.50 FEET TO A 5/8" IRON ROD WITH YELLOW PLASTIC CAP STAMPED "LJA SURVEYING" SET FOR CORNER; SOUTH 16 DEGREES 40 MINUTES 30 SECONDS WEST, A DISTANCE OF 597.04 FEET TO A 1/2" IRON ROD FOUND FOR AN INTERIOR ELL CORNER OF SAID 148.68 ACRE TRACT AND THE COMMON SOUTHWEST CORNER OF SAID 33 ACRE TRACT; SOUTH 63 DEGREES 20 MINUTES 08 SECONDS EAST, DEPARTING SAID COUNTY ROAD NO. 286, A DISTANCE OF 1552.52 FEET TO A TxDOT MONUMENT WITH ALUMINUM DISC FOUND FOR THE NORTHEAST CORNER OF SAID 148.68 ACRE TRACT. SAID POINT BEING ON THE WEST RIGHT-OF-WAY LINE OF AFORESAID U.S. HIGHWAY NO. 75, FROM WHICH A TxDOT MONUMENT WITH BRASS DISC FOUND BEARS NORTH 00 DEGREES 38 MINUTES 39 SECONDS WEST, A DISTANCE OF 12.19 FEET; THENCE, ALONG THE EAST LINE OF SAID 148.68 ACRE TRACT AND SAID COMMON WEST RIGHT-OF-WAY LINE, THE FOLLOWING COURSES AND DISTANCES: SOUTH 00 DEGREES 10 MINUTES 25 SECONDS EAST, A DISTANCE OF 150.17 FEET TO A TxDOT MONUMENT WITH BRASS DISC FOUND FOR CORNER; SOUTH 07 DEGREES 36 MINUTES 36 SECONDS WEST, A DISTANCE OF 500.39 FEET TO A TxDOT MONUMENT WITH BRASS DISC FOUND FOR CORNER; SOUTH 09 DEGREES 37 MINUTES 12 SECONDS WEST, A DISTANCE OF 400.10 FEET TO A TxDOT MONUMENT WITH BRASS DISC FOUND FOR CORNER; SOUTH 06 DEGREES 39 MINUTES 30 SECONDS WEST, A DISTANCE OF 696.34 FEET TO THE POINT OF BEGINNING AND CONTAINING A CALCULATED AREA OF 17,008,076 SQUARE FEET OR 390.452 ACRES OF LAND. 9 LESS AND EXCEPT: TRACT 1: 30.000 ACRES BEING A 30.000 ACRE TRACT OF LAND SITUATED IN THE R. JOHNSON SURVEY, ABSTRACT NO. 479, THE W. KITCHINGS SURVEY, ABSTRACT NO. 504 AND THE T. RATTAN SURVEY ABSTRACT NO. 782, CITY OF ANNA, COLLIN COUNTY, TEXAS, AND BEING PART OF A 148.68 ACRE TRACT OF LAND, CONVEYED TO F.A. MILLER, AS RECORDED IN COUNTY CLERK’S FILE NO. 19960321000231110, OFFICIAL PUBLIC RECORDS, COLLIN COUNTY, TEXAS. SAID 30.000 ACRE TRACT, WITH BEARING BASIS BEING GRID NORTH, TEXAS STATE PLANE COORDINATES, NORTH CENTRAL ZONE NAD83, (NAD83 (2011) EPOCH 2010), DETERMINED BY GPS OBSERVATIONS, CALCULATED FROM COLLIN CORS ARP (PID-DF8982), AND DENTON CORS ARP (PID- DF8986), AND BEING MORE PARTICULARLY DESCRIBED BY METES AND BOUNDS AS FOLLOWS: BEGINNING AT A TxDOT HIGHWAY MONUMENT WITH ALUMINUM DISC FOUND FOR THE SOUTHEAST CORNER OF SAID 148.68 ACRE TRACT AND THE COMMON NORTHEAST CORNER OF COFFMAN CEMETERY, (NO RECORD DOCUMENT FOUND). SAID POINT BEING ON THE WEST RIGHT-OF-WAY LINE OF U.S. HIGHWAY NO. 75, (A VARIABLE WIDTH RIGHT-OF-WAY); THENCE, ALONG THE COMMON LINES OF SAID 148.68 ACRE TRACT AND SAID COFFMAN CEMETERY, THE FOLLOWING COURSES AND DISTANCES: NORTH 89 DEGREES 48 MINUTES 27 SECONDS WEST, A DISTANCE OF 322.00 FEET TO A 5/8" IRON ROD WITH YELLOW PLASTIC CAP STAMPED "LJA SURVEYING" SET FOR AN INTERIOR ELL CORNER OF SAID 148.68 ACRE TRACT AND THE COMMON NORTHWEST CORNER OF SAID CEMETERY; SOUTH 01 DEGREE 32 MINUTES 33 SECONDS WEST, A DISTANCE OF 93.00 FEET TO A 5/8" IRON ROD WITH YELLOW PLASTIC CAP STAMPED "LJA SURVEYING" SET FOR AN EXTERIOR ELL CORNER OF SAID 148.68 ACRE TRACT. SAID POINT BEING ON THE NORTH LINE OF A 97.682 ACRE TRACT OF LAND CONVEYED TO RATTAN PROPERTIES, LTD., AS RECORDED IN VOLUME 4820, PAGE 2729, OFFICIAL PUBLIC RECORDS, COLLIN COUNTY, TEXAS AND BEING WITHIN COUNTY ROAD NO. 284, A PRESCRIPTIVE RIGHT-OF-WAY, BY USE AND OCCUPATION); THENCE, NORTH 88 DEGREES 35 MINUTES 24 SECONDS WEST, ALONG THE SOUTH LINE OF SAID 148.68 ACRE TRACT AND THE COMMON NORTH LINE OF SAID 97.682 ACRE TRACT, WITH SAID COUNTY ROAD NO. 284, A DISTANCE OF 470.36 FEET TO A 5/8" IRON ROD WITH YELLOW PLASTIC CAP STAMPED "LJA SURVEYING" SET FOR CORNER; THENCE, NORTH 13 DEGREES 05 MINUTES 58 SECONDS EAST, OVER AND ACROSS SAID 148.68 ACRE TRACT, A DISTANCE OF 2131.68 FEET TO A 5/8" IRON ROD WITH YELLOW PLASTIC CAP STAMPED "LJA SURVEYING" SET FOR CORNER ON THE NORTH LINE OF 10 SAID 148.68 ACRE TRACT AND THE COMMON SOUTH LINE OF A 33 ACRE TRACT OF LAND CONVEYED TO MIXON REALITY CO., AS RECORDED IN COUNTY CLERK’S FILE NO. 20110407000364750, OFFICIAL PUBLIC RECORDS, COLLIN COUNTY, TEXAS; THENCE, SOUTH 63 DEGREES 20 MINUTES 08 SECONDS EAST, ALONG SAID COMMON LINE, A DISTANCE OF 587.47 FEET TO A TxDOT MONUMENT WITH ALUMINUM DISC FOUND FOR THE NORTHEAST CORNER OF SAID 148.68 ACRE TRACT. SAID POINT BEING ON THE WEST RIGHT-OF-WAY LINE OF AFORESAID U.S. HIGHWAY NO. 75, FROM WHICH A TxDOT MONUMENT WITH BRASS DISC FOUND BEARS NORTH 00 DEGREES 38 MINUTES 39 SECONDS WEST, A DISTANCE OF 12.19 FEET; THENCE, ALONG THE EAST LINE OF SAID 148.68 ACRE TRACT AND SAID COMMON WEST RIGHT-OF-WAY LINE, THE FOLLOWING COURSES AND DISTANCES: SOUTH 00 DEGREES 10 MINUTES 25 SECONDS EAST, A DISTANCE OF 150.17 FEET TO A TxDOT MONUMENT WITH BRASS DISC FOUND FOR CORNER; SOUTH 07 DEGREES 36 MINUTES 36 SECONDS WEST, A DISTANCE OF 500.39 FEET TO A TxDOT MONUMENT WITH BRASS DISC FOUND FOR CORNER; SOUTH 09 DEGREES 37 MINUTES 12 SECONDS WEST, A DISTANCE OF 400.10 FEET TO A TxDOT MONUMENT WITH BRASS DISC FOUND FOR CORNER; SOUTH 06 DEGREES 39 MINUTES 30 SECONDS WEST, A DISTANCE OF 696.34 FEET TO THE POINT OF BEGINNING AND CONTAINING A CALCULATED AREA OF 1,306,800 SQUARE FEET OR 30.000 ACRES OF LAND. EXHIBIT B CITY OF ANNA, TEXAS NOTICE OF PUBLIC HEARING REGARDING THE DISSOLUTION OF THE CRYSTAL PARK PUBLIC IMPROVEMENT DISTRICT Pursuant to Sections 372.011 and 372.009 of the Texas Local Government Code, as amended (the “Act”), notice is hereby given that the City Council of the City of Anna, Texas (“City”), will hold a public hearing to accept public comments and discuss the petition (the “Petition”), filed by Bloomfield Homes, L.P. a Texas limited partnership (the Petitioner”), requesting that the City dissolve the Crystal Park Public Improvement District (the “District”) to include property owned by the Petitioner and further described herein (the “Property”). Time and Place of the Hearing. The public hearing will start at 6:00 p.m. on February 11, 2025 at the Anna City Hall, Council Chambers, 120 W. 7th Street,, Anna, Texas 75409. General Nature of the Proposed Authorized Improvements. The general nature of the proposed public improvements collectively, the "Authorized Improvements") were proposed to include: (a) acquisition, construction and improvements, and maintenance of the improvements, consisting of (i) street, roadway and sidewalk improvements, including related drainage, utility relocation, signalization, landscaping, lighting, signage, off-street parking and right-of-way; (ii) drainage improvements and facilities; (iii) parks, trails and recreational facilities improvements; (iv) projects similar to those listed above authorized by the Act, including similar off-site projects that provide a benefit to the Property within the District; (v) acquisition of real property, interests in real property, or contract rights in connection with each Authorized Improvement; vi) payment of costs, including, without limitation, design, engineering, permitting, legal, required payment, performance and maintenance bonds, bidding, support, construction, construction management, administrative and inspection costs, associated with developing and financing the public improvements listed in (i) through (v) above; (vii) payment of costs associated with operating and maintaining the public improvements listed in (i) through (v) above; (viii) payment of costs of establishing, administering, and operating the District, as well as the interest, costs of issuance, reserve funds, or credit enhancement of bonds issued for the purposes described in (i) through (viii) above (collectively, the “Authorized Improvements”); and (b) the payment of expenses incurred in the establishment, administration, and operation of the District, including maintenance costs, costs of issuance, funding debt service and capitalized interest reserves and credit enhancement fees of any bonds issued by or on behalf of the District, if necessary. These Authorized Improvements were to promote the interests of the City and confer a special benefit upon the Property. Estimated Cost of the Authorized Improvements. The estimated cost to design, acquire and construct the Authorized Improvements, together with bond issuance costs, eligible legal and financial fees, eligible credit enhancement costs and eligible costs incurred in establishment, administration and operation of the District was not to exceed $50,000,000. Proposed District Boundaries. The District was proposed to include approximately 360.452 acres of land located within the corporate limits of the City, and as more particularly described by a metes and bounds description available for public inspection at the office of the City Secretary, 120 W. 7th Street,, Anna, Texas 75409. Proposed Method of Assessment. The City was expected to levy assessments on each parcel within the District in a manner that resulted in imposing equal shares of the costs on property similarly benefited. All assessments may be paid in full at any time (including interest and principal), and certain assessments may be paid in annual installments (including interest and principal). If an assessment is allowed to be paid in installments, then the installments must be paid in amounts necessary to meet annual costs for those Authorized Improvements financed by the assessment, and must continue for a period necessary to retire the indebtedness of those Authorized Improvements (including interest). Proposed Apportionment of Cost between the District and the City. The City was not obligated to provide any funds to finance the Authorized Improvements, except for assessments levied on real property within the District and possible tax increment reinvestment zone revenue. All of the costs of the Authorized Improvements were to be paid from assessments and from other sources of funds, if any, available to the Petitioner. During the public hearing, any interested person may speak for or against the dissolution of the District and the advisability of the improvements that were to be made for the benefit of the property within the District. Item No. 6.d. City Council Agenda Staff Report Meeting Date: 1/14/2025 Staff Contact: Steven Smith AGENDA ITEM: Approve a Resolution authorizing the City Manager to execute Amendment Proposal Number 5 for the Hurricane Creek Regional Wastewater Treatment Plant Construction. Public Works Director Steven Smith) SUMMARY: This item is to approve the next major component in the construction process of the Hurricane Creek Regional Wastewater Treatment Plant construction project, Proposal Amendment Number 5, which includes the Above Ground Mechanical, Architectural, & Finish Grade Package, and the Electrical and Instrumentation Package. FINANCIAL IMPACT: Funding for the Hurricane Creek Regional Wastewater Treatment Plant project was appropriated in the FY2024 Community Investment Program budget in the amount of 65 million from the Utility Bond Fund. The estimated cost of this project phase is $44.9 Million. The project timeline goes into 2027, with future funding allocations projected for the FY2025-2026 Budget and the FY2026-2027 Budget. BACKGROUND: Garney Construction was selected as the Construction Manager At Risk for the Hurricane Creek Regional Wastewater Treatment Plant project. Garney has been bidding and self-performing various portions of the project scope, as each package is ready for implementation. The attached Amendment Proposal Number 5 is the next step in the project process, and will include critical above ground equipment, final grading of the site, and electrical and instrumentation equipment. This amendment is part of the overall project scope already included in the project. As each component is bid and receives final pricing, the component package is brought to the City Council for approval as a best practice for financial management of the project. The project is currently on-schedule and on-budget. The project is currently funded through the original Utility Bond Funds, which funds the site work, underground piping, temporary package plant, and getting the plant up and running. Additional project funding for the completion of the 2MGD permanent plant will be brought to the City Council int he Summer of 2025, for inclusion in the FY2025-2026 Budget. STRATEGIC CONNECTIONS: This item supports the City of Anna Strategic Plan, specifically advancing the strategic outcome area: Resilient. ATTACHMENTS: 1. Resolution -Garney Proposal Amendment 5 2. Amendment Proposal No. 5 CITY OF ANNA, TEXAS RESOLUTION NO. _______________ A RESOLUTION OF THE CITY OF ANNA, TEXAS, AUTHORIZING THE CITY MANAGER TO EXECUTE PURCHASE ORDERS IN THE AMOUNT NOT TO EXCEED FOURTY-FOUR MILLION EIGHT HUNDRED NINETY-SIX THOUSAND FOUR HUNDRED FIFTEEN DOLLARS AND ZERO CENTS ($44,896,415.00) TO GARNEY COMPANIES, INCORPORATED FOR THE CONSTRUCTION AND INSTALLATION OF EQUIPMENT AND MATERIALS AT THE HURRICANE CREEK REGIONAL WASTEWATER TREATMENT PLANT; AND PROVIDING FOR AN EFFECTIVE DATE. WHEREAS, the Hurricane Creek Regional Wastewater Treatment project is identified as a Community Investment Program construction project in the City of Anna; and, WHEREAS, the City completed a publicly advertised request for proposal process for Construction Manager At Risk Services for the project, and opened the proposals on June 29, 2023; and, WHEREAS, Council awarded the contract to Garney Companies, Incorporated to represent the City of Anna as the Construction Manager At Risk for the project in Resolution 2023-07-1495 on July 25, 2023; and, WHEREAS, funding for the project, including the above packages, is included in the adopted Fiscal Year 2024-25 Budget, as shown in the City of Anna Capital Improvement Plan; and, WHEREAS, Garney Companies, Incorporated utilized design plans and specifications for the project to bid out the WRF Above Ground Mechanical, Architectural, & Finish Grade Package, and the WRF Electrical & Instrumentation Package as explained in Exhibit A, with bid results and scores shown in Exhibit B. NOW THEREFORE, BE IT RESOLVED BY THE CITY COUNCIL OF THE CITY OF ANNA, TEXAS THAT: Section 1.Recitals Incorporated The recitals above are incorporated herein as if set forth in full for all purposes. Section 2.Authorization of Payment and Funding. That the City Council of the City of Anna hereby authorizes the City Manager to execute a purchase order in the amount not to exceed $44,896,415.00 to Garney Companies, Incorporated for the Bid Packages Shown in Exhibit B. PASSED AND APPROVED by the City Council of the City of Anna, Texas on this ___ day of January 2025. ATTEST: APPROVED: City Secretary, Carrie Land Mayor, Pete Cain Exhibit A – Amendment Proposal No. 5 Summary Exhibit B – Bid Results & Evaluation Scores HURRICANE CREEK REGIONAL WATER RECLAMATION FACILITY & TEMPORARY TREATMENT FACILITY CITY OF ANNA Amendment Proposal No. 5 – Solicitation Set No. 3 – Regional Water Reclamation Facility Work Packages SUBMITTED BY: GARNEY COMPANIES, INC. 1700 Swift Street North Kansas City, MO 64116 1700 Swift Street, North Kansas City, MO 64116 Phone: 816.741.4600 www.garney.com Steven Smith January 6, 2025 Director of Public Works 120 W 7th ST Anna, Texas 75409 RE: Hurricane Creek Regional Water Reclamation Facility & Temporary Treatment Facility Subject: Amendment Proposal No. 5 Transmittal Letter Mr. Smith, Garney Companies, Inc. is pleased to submit the attached Amendment Proposal No. 5 for the Hurricane Creek Regional Water Reclamation Facility & Temporary Treatment Facility for Council review and approval. This proposal is submitted per Paragraph 9.03 of the agreement between Garney Companies, Inc., and the City of Anna. This Amendment Proposal is for the following Bid Packages. BP 3.01 – WRF Above Ground Mechanical, Architectural & Finish Grade Package. BP 3.02 – WRF Electrical & Instrumentation Package Garney is excited to start construction and be an integral part of this project for the City of Anna. Please contact Garney directly if there are any questions regarding this Amendment Proposal. Sincerely, GARNEY COMPANIES, INC. Jeremy Miller Project Manager CC: Patrick Vidonish – Garney Mark Miner – Garney Kyle Kubista – Kimley-Horn 1700 Swift Street, North Kansas City, MO 64116 Phone: 816.741.4600 www.garney.com TABLE OF CONTENTS Transmittal Letter Table of Contents Tab 1 Executive Summary Tab 2 List of Drawings, Specifications and Other Contract Documents Tab 3 Description of Variations, Substitutions, Clarifications and Assumptions Tab 4 Cost of Work Breakdown Tab 5 Schedule Information Tab 6 Other Documentation Tab 1 1700 Swift Street, North Kansas City, MO 64116 Phone: 816.741.4600 www.garney.com Steven Smith January 6, 2025 Director of Public Works 120 W 7th ST Anna, Texas 75409 RE: Hurricane Creek Regional Water Reclamation Facility & Temporary Treatment Facility Subject: Executive Summary – Amendment Proposal No. 5 Mr. Smith, In accordance with the Agreement between Garney Companies, Inc., and the City of Anna, Garney is pleased to provide attached proposal in the amount of $44,896,415.00 (Per the attached Cost of Work Breakdown) for the Hurricane Creek Regional Water Reclamation Facility & Temporary Treatment Facility, and requests that the City of Anna authorize this by amendment to the Original Agreement. Garney is submitting this proposal, with attachments listed in the Table of Contents, in accordance with the paragraph 9.03 of the Construction Manager at Risk Services Agreement for the Hurricane Creek Regional Water Reclamation Facility & Temporary Treatment Facility. This proposal includes the following scopes of work. BP 3.01 - WRF Above Ground Mechanical, Architectural & Finish Grade Package – This package includes mobilizing equipment to the project needed for this scope of work. The package also includes All above ground mechanical piping, handrail and grating, mechanical equipment and accessories that was not pre-selected. This package includes all precast panels, double tees, pre-engineered metal canopies, masonry, standing seam roofing, framing, drywall, tile, millwork, HVAC, and plumbing trim out. Also included is all storm drain pipe and channel, finish grade and seeding. BP 3.02 - WRF Electrical & Instrumentation Package – This package includes mobilizing equipment to the project needed for this scope of work. The package also includes all duct banks, electrical gear, generator, conduit, wire, instrumentation, software, programming, PLC’s, local control panels, and integration for a complete electrical and instrumentation package. Upon approval and receipt of an amendment to the Original Agreement, Garney will finalize contract negotiations with suppliers/subcontractors as applicable to move forward with the procurement of these bid packages in accordance with the requirements of the agreement. The prices included in this proposal are contingent upon Garney being able to successfully enter into contracts with the supplier/subcontractors. Please contact Garney directly if there are any questions regarding the Bid Packages, Cost of Work, General Conditions or associated Construction Manager at Risk fees included in this proposal. Sincerely, GARNEY COMPANIES, INC. Jeremy Miller Project Manager Tab 2 1700 Swift Street, North Kansas City, MO 64116 Phone: 816.741.4600 www.garney.com TAB 2 – LIST OF DRAWINGS AND SPECIFICATIONS AND OTHER CONTRACT DOCUMENTS Drawings: Solicitation Set No. 3 Plans - Hurricane Creek Regional Water Reclamation Facility – 100% Design – Dated July 2024. Specifications: Solicitation Set No. 3 Technical Specifications - Hurricane Creek Regional Water Reclamation Facility – 100% Technical Specifications – Sealed July 2024. Other Documents: Addendum 1 dated November 2024. Addendum 2 dated December 2024. All Documents can be downloaded at the following location. SS #3 Documents on CIVCAST.com Tab 3 1700 Swift Street, North Kansas City, MO 64116 Phone: 816.741.4600 www.garney.com TAB 3 – DESCRIPTION OF VARIATIONS, SUBSTITUTIONS, CLARIFICATIONS AND ASSUMPTIONS PROPOSED TO THE DRAWINGS AND SPECIFICATIONS. Clarifications: Pricing of this proposal is contingent upon Garney receiving a contract amendment by January 19, 2025. The scope of this proposal is limited to the scope outlined in the bidding documents listed in Tab 2 of this proposal. This proposal includes startup services as outlined in 01 75 00 Starting and Adjusting. It is Garney’s understanding that all chemicals/dumpsters needed for and after startup are to be provided by the City of Anna. Garney will not be responsible for operation of equipment during treatment of influent and discharge of effluent. Operation of equipment during treatment of influent and discharge of effluent will be performed by the City of Anna’s operation staff, with Garney’s assistance. Exclusions: Chemical drums, totes, and chemicals required to treat the water during and after startup and commissioning are provided by Owner. Dumpsters shown in the plans, required for operation are provided by Owner. Trucking of sludge for seeding provided by Owner. Section 26 21 00 – Electrical Service: Electrical Utility Charges for extension of distribution system to the point of service termination and meters will be paid for by the Owner. Cost for permanent power and electricity consumed by operation of equipment during and after startup and commissioning will be paid for by the Owner. Costs associated with building permits are excluded. Tab 4 1700 Swift Street, North Kansas City, MO 64116 Phone: 816.741.4600 www.garney.com TAB 4 – COST OF WORK BREAKDOWN. Tab 5 1700 Swift Street, North Kansas City, MO 64116 Phone: 816.741.4600 www.garney.com TAB 5 – SCHEDULE INFORMATION. 1. Please see the Schedule Attached. Tab 6 1700 Swift Street, North Kansas City, MO 64116 Phone: 816.741.4600 www.garney.com TAB 6 – OTHER DOCUMENTATION Solicitation Set No. 3 Evaluation Scores BP 3.01 – WRF Above Ground Mechanical, Architectural & Finish Grade Package BP 3.02 – WRF Electrical & Instrumentation Package Item No. 7.a. City Council Agenda Staff Report Meeting Date: 1/14/2025 Staff Contact: Stephanie Scott-Sims AGENDA ITEM: Conduct a Public Hearing/Consider/Discuss/Action on an Ordinance to amend an existing Planned Development (Ord. No. 648-2014) to allow for a commercial drone delivery hub as an accessory use, located on the west side of Buddy Hayes Boulevard, 265± feet north of W. White Street. Zoned Planned Development (Ord. No. 648-2014). PD 24-0005) (Director of Development Services Stephanie Scott-Sims) SUMMARY: A retail store building on one lot on 18.5± acres, on the west side of S. Buddy Hayes Boulevard, 265± feet north of W. White Street. Zoned Planned Development (Ord. 648- 2014). The Planning & Zoning Commission recommended approval with the condition of amending the definition of Commercial drone delivery hub, (7-0) at their December 4, 2024 meeting. FINANCIAL IMPACT: This item has no financial impact. BACKGROUND: History: Ordinance No. 120-2003 – Annexed and zoned 98.2± acres to Planned Development with modified C-2 uses. December 9, 2003. Ordinance No. 121-2003 – Annexed and zoned 9.1± acres to Planned Development with modified C-2 uses. December 9, 2003. Ordinance No. 648-2014 - Rezoned by repeal of Ordinance No. 120-2003 and Ordinance No.121-2003 and replaced with Planned Development zoning with modified C-2 uses and standards. January 28, 2014. Case Overview The applicant is proposing to add a commercial drone delivery hub as an accessory use to the retail store. Staff mailed public hearing notices to surrounding property owners in accordance with state law. To date, Staff has not received any input comments on this case. Direction Land Use Zoning Comprehensive Plan North Vacant Zoned PD (Ord. 648- 2014) Regional Activity Center East Vacant lot and Hotel Zoned PD (Ord. 648- 2014) Urban Living South Four commercial/retail lots Zoned PD (Ord. 648- 2014) Regional Activity Center West Three restaurant and restaurant/retail lots Two zoned PD (Ord. 648-2014), and one zoned PD (Ord. 648- 2014 & Ord. 826-2019) Regional Activity Center Compatibility Considerations This request will not change the base zoning, Regional Commercial (C-2), of the Planned Development and is generally in conformance with the Anna 2050 Comprehensive Plan. The Zoning Ordinance does not currently address the emerging technology of drone delivery. Staff researched standards used by other Texas cities and are proposing the following: Restricting the outdoor storage location to the equipment area as shown on the site plan associated with this request. Restricting the area for outdoor storage to a maximum of 5,000 square feet. Establishing screening standards: o A minimum 8-foot-tall black ornamental screen with unobstructed view shall be provided around all outdoor storage areas. Requiring additional landscaping to provide screening from the equipment:. o Additional trees within or adjacent to the landscape buffer shall be provided along Buddy Hayes Boulevard to create a screening effect of the commercial drone delivery hub equipment and must contain: One (1) canopy tree per 40 linear feet of street frontage and One (1) ornamental tree per 20 linear feet of fencing The applicant is not requesting to reduce or remove parking spaces from the site. During the Planning & Zoning Commission meeting, the applicant requested a modification to the proposed definition of Commercial drone delivery hub: An area of land, structural surface, building, or structure with one or more designated drone staging areas for use by small unmanned aircraft systems (sUAS) approved by the Federal Aviation Administration under 55 pounds total take-off weight or as defined in Section 44801 of Title 49, United States Code, as amended, whichever is the lesser, to distribute commercial goods by air. This includes any appurtenant areas used or intended for use for unmanned aircraft system buildings, structures, and other facilities. STRATEGIC CONNECTIONS: This item supports the City of Anna Strategic Plan, specifically advancing the strategic outcome area: Unique. ATTACHMENTS: 1. Locator Map - Walmart Anna Addition, Block A, Lot 1 Zoning 2. Ordinance - Walmart Anna Addition, Block A, Lot 1 3. Exhibit A - Walmart Anna Addition, Block A, Lot 1, Legal Description 4. Exhibit B - Walmart Anna Addition, Block A, Lot 1, Site Plan 5. P&Z Staff Report - Zoning, Walmart Anna Addition, Block A, Lot 1 PARKVIEW DR PINE KNOLLWAYSTANLEYFALLSDRN CENTRALEXPYHAWTHORNE RDSCENTRALEXPYUS HIGHWAY 75HELMOKEN FALLS DR HANAKOA FALLS DR ATHABASCA FALLS DR TANUR CASCADE DR H A R D W O O D CTCOTTONWOODTRLPENTONLINNS DRCREEKMEADOW CTLAKESHORE DR HILLSIDE DR CREEKMEADOWDRTRA ILW OO D D R CEDAR TRL W WHITEST OLDWARRIOR RDWILEY FARMNBUDDYHAYESBLVDSPRINGVALLEYWAYSUZIELNSBUDDYHAYESBL V D HILLTOPDRCREEKSIDEDRCREEKVIEWDRNIAGARAFALLSDRHARDWOODT RL HACKBERRY DR WI NDI NGCREEKL NTIMBER RIDGE DR S S T A N D R ID G E B L V DPERSI MMONDREast ForkTr i n it y R i v er121 V a n A l s t y n e 75 SH 121 SH 5 Subject Property 200' Notice Boundary City LimitsETJ 0 500 1, 000250 Feet November 2024 C:\Users\cbrooks\OneDrive - City of Anna\GIS\ Notification Maps\ Notification Maps\Anna Walmart Zoning (PD 24-0005)Inset Map Walmart Anna Addition, Block A, Lot 1 1 CITY OF ANNA, TEXAS Property zoned under this ordinance is generally located on the west side of Buddy Hayes Boulevard, 265± feet north of W. White Street ORDINANCE NO. ________________ AN ORDINANCE OF THE CITY OF ANNA, TEXAS AMENDING THE CITY’S COMPREHENSIVE PLAN, ZONING MAP, AND ZONING ORDINANCE AND CHANGING THE ZONING OF CERTAIN PROPERTY AS DESCRIBED HEREIN; PROVIDING FOR SAVINGS, REPEALING AND SEVERABILITY CLAUSES; PROVIDING FOR AN EFFECTIVE DATE; PROVIDING FOR A PENALTY CLAUSE NOT TO EXCEED $2,000 OR THE HIGHEST PENALTY AMOUNT ALLOWED BY LAW, WHICHEVER IS LESS; AND, PROVIDING FOR THE PUBLICATION OF THE CAPTION HEREOF. WHEREAS, the City of Anna, Texas (“City”) has previously adopted ordinances, rules and regulations governing the zoning in the City; and WHEREAS, the City has received a request to amend the zoning and development regulations in Ordinance No. 648-2014 as amended from Matt Philpott (Walmart Sr. Project Manager) on Property described and depicted in Exhibit 1 (“Property”) attached hereto and incorporated herein for all purposes as if set forth in full; and WHEREAS, the Planning and Zoning Commission of the City and the City Council of the City of Anna (“City Council”) have given the requisite notices by publication and otherwise and have held the public hearings as required by law and afforded a full and fair hearing to all property owners and generally to all persons interested in and situated in the affected area and in the vicinity thereof, the City Council has concluded that the Zoning Ordinance of the City should be amended as set forth below. NOW, THEREFORE, BE IT ORDAINED BY THE CITY COUNCIL OF THE CITY OF ANNA, TEXAS THAT: Section 1.Recitals Incorporated The above recitals are incorporated herein by reference for all purposes. Section 2.Zoning Ordinance Amended The Anna City Code of Ordinances (the “Anna Code”) and Planned Development (Ord. No. 648-2014) are hereby amended by amending the zoning of the Property as described on the attached Exhibit A and depicted on the attached Exhibit B. 1. Purpose. The purpose of this Planned Development amendment is to add an accessory use of commercial drone delivery hub to the existing retail building site. 2 2. Definitions. Except as otherwise provided herein, the definitions in Appendix 3 of the City’s Zoning Ordinance shall apply. Commercial drone delivery hub – An area of land, structural surface, building, or structure with one or more designated drone staging areas for use by unmanned aircraft systems (UAS) approved by the Federal Aviation Administration to distribute commercial goods by air. This includes any appurtenant areas used or intended for use for unmanned aircraft system buildings, structures, and other facilities. 3. Development Standards. A. The location of the commercial drone delivery hub shall be designated on an approved site plan and shall not be placed: 1. Within any required building setbacks; 2. Within any required landscape edge; 3. Within fire lanes, easements, maneuvering aisles, customer pick-up lanes, or required loading zones and parking spaces; or 4. So as to obstruct visibility or interfere with pedestrian or vehicle circulation. B. Standards and Area Regulations: Development must comply with the development standards for use, density, lot area, lot width, lot depth, yard depths and widths, building height, building elevations, coverages, floor area ratio, parking, access, screening, landscaping, accessory buildings, signs, and lighting, set forth in the Regional Commercial (C-2) zoning district and the Planning and Development Regulations except as modified per Ord. No. 648-2014 and as otherwise specified herein. 1. Retail standards: i. Commercial drone delivery hub is permitted as an accessory use on Walmart Anna Addition, Block A, Lot 1. 2. Commercial drone delivery hub standards: i. Commercial drone delivery hub area shall not exceed 5,000 square feet. ii. Screening: A minimum eight-foot-tall (8’) black ornamental screen shall be provided around all outdoor storage areas. 3 iii. Additional landscaping within or adjacent to the landscape buffer shall be provided along Buddy Hayes Boulevard to create a screening effect of the commercial drone delivery hub equipment and must contain: 1. One (1) canopy tree per 40 linear feet of street frontage and 2. One (1) ornamental tree per 20 linear feet of fencing around the commercial drone delivery hub. iv. Parking: No additional parking spaces are required. Section 3.Official Zoning Map The official Zoning Map of the City shall be corrected to reflect the change in zoning described herein. Section 4.Savings, Repealing and Severability Clauses It is hereby declared to be the intention of the City Council that the words, sentences, paragraphs, subdivisions, clauses, phrases, and provisions of this ordinance are severable and, if any phrase, sentence, paragraph, subdivision, clause, or provision of this ordinance shall be declared unconstitutional or otherwise invalid or inapplicable by the valid judgment or decree of any court of competent jurisdiction, such unconstitutionality, invalidity or inapplicability shall not affect any of the remaining words, sentences, paragraphs, subdivisions, clauses, phrases, or provisions of this ordinance, since the same would have been enacted by the City Council without the incorporation in this ordinance of any such unconstitutional, invalid or inapplicable words, sentences, paragraphs, subdivisions, clauses, phrases, or provisions. Further, all ordinances or parts of ordinances in force when the provisions of this ordinance become effective that are consistent and do not conflict with the terms and provisions of this ordinance are hereby ratified to the extent of such consistency and lack of conflict, and all ordinances or parts of ordinances in force when the provisions of this ordinance become effective that are inconsistent or in conflict with the terms and provisions contained in this ordinance are hereby repealed only to the extent of any such conflict. Notwithstanding any provision of this ordinance or the Anna Code, it is intended that this ordinance fully comply with Chapter 3000 of the Texas Government Code (“Chapter 3000”) and this ordinance shall and the City Code shall be interpreted in a manner to comply with Chapter 3000. For the purposes of this ordinance, any provision of the City Code that does not comply with Chapter 3000 shall be deemed to have been excluded and not a part of this ordinance. Section 5.Penalty Any violation of any of the terms of this ordinance, whether denominated in this ordinance as unlawful or not, shall be deemed a misdemeanor. Any person convicted of any such violation shall be fined in an amount not to exceed $2,000 for each incidence of violation. Each day a violation exists is considered a separate offense and will be punished separately. 4 Section 6.Publication of the Caption and Effective Date This ordinance shall be effective upon its passage by the City Council, approval by the Mayor, and posting and/or publication, if required by law, of its caption. The City Secretary is hereby authorized and directed to implement such posting and/or publication. PASSED by the City Council of the City of Anna, Texas this 14th day of January 2025. ATTESTED: APPROVED: Carrie L. Land, City Secretary Pete Cain, Mayor Legal description of the land BEING a tract of land situated in the Thomas Ratton Survey, Abstract No. 782, and the W.S. Ratton Survey, Abstract No. 752, City of Anna, Collin County, Texas, and being all of a called 18.551 acre tract of land described in the deed to Wal-Mart Real Estate Business Trust, recorded in Instrument No. 20150602000647410, Real Property Records of Collin County, Texas, and a portion of a called 107.52 acre tract of land described in the deed to Q Seminole Anna Town Center, L.P., recorded in Instrument No. 20080128000100640, said Real Property Records, and being more particularly described as follows: BEGINNING at a 5/8 inch iron rod with plastic cap stamped with "KHA" set for the southeast corner of said 18.551 acre tract and on the northerly line of F.M. 455 (White Road), from which the southeast corner of said 107.52 acre tract bears North 88°02'21" East a distance of 240.37 feet, South 86°53'28" East a distance of 211.81 feet, and South 79°25'49" East a distance of 46.42 feet, said southeast corner of said 107.52 acre tract being monumented by a 1/2 inch iron rod that bears North 00°14' East a distance of 0.36 feet; THENCE South 88°02'21" West, along the southerly line of said 18.551 acre tract and along the northerly right-of-way line of F.M. 455, a distance of 169.65 feet to 1/2 inch iron rod with plastic cap stamped "GEER 4117" found for corner; THENCE South 85°33'01" West, continuing along the southerly line of said 18.551 acre tract and along the northerly right-of- way line of F.M. 455, a distance of 1.24 feet to a 5/8 inch iron rod with plastic cap stamped with "KHA" set for the southern -most southwest corner of said 18.551 acre tract, from which an aluminum TxDOT right-of-way monument found at the southern-most southwest corner of said 107.52 acre tract bears South 87°15'24" West a distance of 182.35 feet; THENCE North 1°56'25" West, departing the northerly right-of-way line of F.M. 455, along a westerly line of said 18.551 acre tract, a distance of 287.52 feet to a 5/8 inch iron rod with plastic cap stamped with "KHA" set for corner; THENCE North 89°46'13" West, along a southerly line of said 18.551 acre tract, a distance of 215.11 feet to a 5/8 inch iron rod with plastic cap stamped with "KHA" set for corner at the beginning of a tangent curve to the right having a central angle of 45°24'44", a radius of 360.50 feet, a chord bearing and distance of North 67°03'51" West, 278.31 feet; THENCE in a northwesterly direction, continuing along a southerly line of said 18.551 acre tract, and with said curve to the right, an arc distance of 285.73 feet to a 5/8 inch iron rod with plastic cap stamped with "KHA" set for corner at the end of said curve; THENCE South 53°03'11" West, continuing along a southerly line of said 18.551 acre tract, a distance of 99.23 feet to a 5/8 inch iron rod with plastic cap stamped "KHA" set for corner at the beginning of a tangent curve to the right having a central angle of 04°31'07", a radius of 546.50 feet, a chord bearing a distance of South 55°18'44" West, 43.09 feet; THENCE in a southwesterly direction, continuing along a southerly line of said 18.551 acre tract, and with said curve to the right, an arc distance of 43.10 feet to a 5/8 inch iron rod with plastic cap stamped "KHA" set for corner at the end of said curve; THENCE South 57°34'17" West, continuing along a southerly line of said 18.551 acre tract, a distance of 151.77 feet to a 5/8 inch iron rod with plastic cap stamped with "KHA" set for a salient corner on the westerly line of said 18.551 acre tract, and on the easterly right-of- way line of U.S. Highway 75, from which an aluminum TxDOT right-of-way monument found at an angle point in said right-of-way line bears South 33°05'36" East a distance of 185.18 feet; THENCE North 33°05'36" West, along the westerly line of said 18.551 acre tract and along the easterly right-of-way line of U.S. Highway 75, a distance of 57.00 feet to a 5/8 inch iron rod with plastic cap stamped with "KHA" set for a salient corner on the westerly line of said 18.551 acre tract; THENCE North 57°34'17" East, departing the easterly right-of-way line of U.S. Highway 75, continuing along the westerly line of said 18.551 acre tract, a distance of 152.43 feet to a 5/8 inch iron rod with plastic cap stamped "KHA" set for corner at the beginning of a tangent curve to the left having a central angle of 04°31'07", a radius of 489.50 feet, a chord bearing and distance of North 55°18'44" East, 38.59 feet; THENCE in a northeasterly direction, continuing along the westerly line of said 18.551 acre tract, and with said curve to the left, an arc distance of 38.60 feet to a 5/8 inch iron rod with plastic cap stamped "KHA" set for corner at the end of said curve; THENCE North 53°03'11" East, continuing along the westerly line of said 18.551 acre tract, a distance of 96.37 feet to a 5/8 inch iron rod with plastic cap stamped with "KHA" set for corner at the beginning of a non-tangent curve to the right having a central angle of 35°30'28", a radius of 360.50 feet, a chord bearing and distance of North 17°31'27" West, 219.85 feet; THENCE in a northwesterly direction, continuing along the westerly line of said 18.551 acre tract, and with said curve to the right, an arc distance of 223.41 feet to a 5/8 inch iron rod with plastic cap stamped with "KHA" set for corner at the end of said curve; THENCE North 0°13'47" East, continuing along the westerly line of said 18.551 acre tract, a distance of 363.50 feet to a 5/8 inch iron rod with plastic cap stamped with "KHA" set for corner; THENCE North 89°46'13" West, continuing along the westerly line of said 18.551 acre tract, a distance of 207.53 feet to a 5/8 inch iron rod with plastic cap stamped with "KHA" set for corner on the proposed easterly right-of-way line of U.S. Highway 75 according to Notice of Lis Pendens, recorded in Instrument No. 20150331000350710, said Real Property Records, which discloses a certain Petition in an eminent domain proceeding numbered 002 -00750- 2015 and styled The State of Texas v. Q Seminole Anna Town Center, LP, a Texas Limited Partnership, et al.; THENCE North 7°36'50" East, continuing along the westerly line of said 18.551 acre tract, and along said proposed easterly right-of-way line of U.S. Highway 75, a distance of 50.92 feet to a 5/8 inch iron rod with plastic cap stamped with "KHA" set for the western-most northwest corner of said 18.551 acre tract, from which a 1/2 inch iron rod with plastic cap stamped "GEER 4117" found at the northwest corner of said 107.52 acre tract, bears North 89°46'13" West a distance of 39.78 feet, North 10°28'35" East a distance of 546.22 feet, North 06°10'54" East a distance of 200.06 feet, North 07°36'50" a distance of 1400.00 feet, North 05°27'50" East a distance of 400.28 feet, and North 10°28'35" East a distance of 360.20 feet; THENCE South 89°46'13" East, departing said proposed easterly right-of-way line of U.S. Highway 75, along the northerly line of said 18.551 acre tract, a distance of 229.49 feet to a 5/8 inch iron rod with plastic cap stamped with "KHA" set for corner; THENCE North 0°13'47" East, continuing along the northerly line of said 18.551 acre tract, a distance of 13.00 feet, to a 5/8 inch iron rod with plastic cap stamped with "KHA" set for corner; THENCE South 89°46'13" East, continuing along the northerly line of said 18.551 acre tract, a distance of 452.85 feet, to a 5/8 inch iron rod with plastic cap stamped with "KHA" set for corner; THENCE North 00°13'47" East, departing the northerly line of said 18.551 acre tract, and crossing aforesaid 107.52 acre tract, a distance of 86.00 feet to a 5/8 inch iron rod with plastic cap stamped with "KHA" set for corner; THENCE South 89°46'13" East, continuing across said 107.52 acre tract, a distance of 498.17 feet to a 5/8 inch iron rod with plastic cap stamped with "KHA" set for corner; THENCE South 0°13'47" West, continuing across said 107.52 acre tract, passing en route at a distance of 86.00 feet the northeast corner of aforesaid 18.551 acre tract, and continuing on said course along the easterly line of said 18.551 acre tract, a total distance of 601.80 feet to a 5/8 inch iron rod with plastic cap stamped with "KHA" set for corner at the beginning of a tangent curve to the right having a central angle of 60°17'02", a radius of 335.00 feet, a chord bearing and distance of South 30°22'17" West, 336.44 feet; THENCE in a southwesterly direction, continuing along the easterly line of said 18.551 acre tract, with said curve to the right, an arc distance of 352.47 feet to a 5/8 inch iron rod with plastic cap stamped with "KHA" set for corner at the end of said curve; THENCE South 60°33'48" West, continuing along the easterly line of said 18.551 acre tract, a distance of 6.34 feet to a 5/8 inch iron rod with plastic cap stamped with "KHA" set for corner; THENCE North 79°55'16" West, continuing along the easterly line of said 18.551 acre tract, a distance of 30.84 feet to a 5/8 inch iron rod with plastic cap stamped with "KHA" set for corner; THENCE South 49°37'03" West, continuing along the easterly line of said 18.551 acre tract, a distance of 69.97 feet to a 5/8 inch iron rod with plastic cap stamped with "KHA" set for corner at the beginning of a non-tangent curve to the right having a central angle of 09°04'37", a radius of 179.50 feet, a chord bearing and distance of South 35°50'39" East, 28.41 feet; THENCE in a southeasterly direction, continuing along the easterly line of said 18.551 acre tract, with said curve to the right, an arc distance of 28.44 feet to a 5/8 inch iron rod with plastic cap stamped with "KHA" set for corner at the beginning of a compound curve to the right having a central angle of 29°21'56", a radius of 90.00 feet, a chord bearing and distance of South 16°37'23" East, 45.62 feet; THENCE in a southeasterly direction, continuing along the easterly line of said 18.551 acre tract, with said compound curve to the right, an arc distance of 46.13 feet to a 5/8 inch iron rod with plastic cap stamped with "KHA" set for corner; THENCE South 01°56'25" East, continuing along the easterly line of said 18.551 acre tract, a distance of 151.55 feet to the POINT OF BEGINNING and containing 19.535 acres 850,935 square feet) of land, more or less. EXISTING RESTAURANT BLK A, LOT 2R PDC - COMMERCIAL EXISTING RETAIL BLK A, LOT 3R PDC - COMMERCIAL EXISTING RESTAURANT BLK A, LOT 4 PDC - COMMERCIAL EXISTING RESTAURANT BLK A, LOT 5 PDC - COMMERCIAL EXISTING RETAIL BLK 1, LOT 1 PDC - COMMERCIAL EXISTING RESTAURANT BLK A, LOT 9 PDC - COMMERCIAL EXISTING FUEL STATION BLK A, LOT 7 PDC - COMMERCIAL EXISTING RETAIL BLK A, LOT 6 PDC - COMMERCIAL EXISTING COMMERCIAL DEVELOPMENT BLK A, LOT 2 PDC - COMMERCIAL EXISTING RESTAURANT BLK A, LOT 10R PDC - COMMERCIAL UNDEVELOPED LAND BLK A, LOT 6R PDC - COMMERCIAL FUTURE HOTEL ABS A0782 TRACT 28 PDC (SUP) - COMMERCIAL FUTURE HOTEL ABS A0288 TRACT 33 PDC (SUP) - COMMERCIAL UNDEVELOPED LAND ABS A0288 TRACT 9 PDC - COMMERCIAL UNDEVELOPED LAND ABS A0752 TRACT 5 PDC - COMMERCIAL UNDEVELOPED LAND ABS A0782 TRACT 1 PDC - COMMERCIAL FUTURE RESIDENTIAL DEVELOPMENT BLK A, LOT 5 MF2 - MULTI-FAMILY RESIDENTIAL SOUTH THROCKMORTON BLVD BUDDY HAYES BLVD N89°42'17"W200.6'S89° 42' 17" E229. 1' N0° 23' 00" E 199. 89' N5 3 0 8 0 9 E 9 6 2 8 N28° 4 6' 5 1" W 26. 65' N57° 33 53 E152. 47 S57° 25 45 W151. 67 S5 3 0 6 5 5 W 9 9 2 7 S4 9 4 0 4 2 W6 97 1N79° 55' 03" W30. 99'S0°22'08"W 415.73' S0°22'08"W 185.07' S2 8 0 1 1 1 W 29. 3 1 N55° 38' 16" XX XUGE CC CC CC CC CC CC CC CC CC CC CC CC CC CC CC CC CC CC CC CC CC CC CC CC CC CC CC CC CC CC CC CC CC CC CC CC CC CC STORE NUMBER 6963-1006 BUILDING AREA = 186,933 S.F. / 4.29 AC 748 SPACES EXISTING RESTAURANT BLK A, LOT 2R PDC - COMMERCIAL EXISTING RETAIL BLK A, LOT 3R PDC - COMMERCIAL EXISTING RESTAURANT BLK A, LOT 4 PDC - COMMERCIAL EXISTING RESTAURANT BLK A, LOT 5 PDC - COMMERCIAL EXISTING RETAIL BLK 1, LOT 1 PDC - COMMERCIAL EXISTING RESTAURANT BLK A, LOT 9 PDC - COMMERCIAL EXISTING FUEL STATION BLK A, LOT 7 PDC - COMMERCIAL EXISTING RETAIL BLK A, LOT 6 PDC - COMMERCIAL EXISTING COMMERCIAL DEVELOPMENT BLK A, LOT 2 PDC - COMMERCIAL GARDEN AREA AUTOMOTIVE CARE AREA EXISTING RESTAURANT BLK A, LOT 10R PDC - COMMERCIAL UNDEVELOPED LAND BLK A, LOT 6R PDC - COMMERCIAL FUTURE HOTEL ABS A0782 TRACT 28 PDC (SUP) - COMMERCIAL FUTURE HOTEL ABS A0288 TRACT 33 PDC (SUP) - COMMERCIAL UNDEVELOPED LAND ABS A0288 TRACT 9 PDC - COMMERCIAL UNDEVELOPED LAND ABS A0752 TRACT 5 PDC - COMMERCIAL UNDEVELOPED LAND ABS A0782 TRACT 1 PDC - COMMERCIAL FUTURE RESIDENTIAL DEVELOPMENT BLK A, LOT 5 MF2 - MULTI-FAMILY RESIDENTIAL SOUTH THROCKMORTON BLVD BUDDY HAYESBLVDE GTGTBENCHMARK 1 BENCHMARK 2 BENCHMARK #3BENCHMARK #4 EXISTING LOADING ZONE EXISTING LOADING ZONE EXISTING DRIVE-THRU LANE EXISTING TRASH DUMPSTER AREA EXISTING STORM PIPE 15' WATER EASEMENT EXISTING LIGHT POLE EXISTING CURB EXISTING 24' FIRE LANE 5' BUILDING SETBACK 25' BUILDING SETBACK 5' BUILDING SETBACK 10' BUILDING SETBACK EXISTING SANITARY SEWER CLEANOUTS EXISTING CURB INLET EXISTING GRATE INLET EXISTING LIGHT POLE EXISTING GRATE INLET EXISTING 20' WATER EASEMENT EXISTING 10' UTILITY EASEMENT EXISTING LIGHT POLE EXISTING 10' UTILITY EASEMENT EXISTING 15' WATER EASEMENT EXISTING SANITARY SEWER MANHOLE EXISTING LIGHT POLE EXISTING FIRE HYDRANT EXISTING LIGHT POLE EXISTING 25' FIRELANE R 5 0 .0 ' R 3 0.0' R 3 0 . 0' R43. 6 R50. 0' R30. 0'R 3 0 0' R 10 0' R10. 0 'R 1 0 0'R 2 5 0'R 1 5. 0' R40. 0' S89° 49' 18" E8. 5' N89°42'17"W200.6'S89° 42'17" E229. 1' N0° 23' 00" E 199. 89' N5 3 0 8 0 9 E 9 6 2 8 N28° 4 6'5 1" W 26. 65'N57°33 53 E152.47 S57°25 45 W151.67 S5 30 65 5W 9 9 27 S4 9 4 0 4 2 W 6 9 7 1 N79° 55'03"W 30. 99' S0° 22' 08" W 415. 73' S0° 22'08" W 185.07'S2 8 0 1 1 1 W 29. 3 1 N55°38'16"W19. 34'N89° 37'26" W177.87'N63°33'51"W26.68'S89°36'31"E92.85'S89°36'32"E405.19'S89°38'16"E452.7'N0°23'36"E 85.96'R1 0 .0'R 5 0.0'R 5 0 .0 'R30.0 'R89. 1'R55. 0'R5 0.0 EXISTING ELECTRIC TRANSFORMER R20.0 'R25 . 0 'R 5 0 . 0 'R36. 0'R30.0'R16.0 'R30.0'R30. 0'R20. 0'R 2 5. 0'R30. 0'R45. 0'R33. 0'R 7 2.0 REFER TO ARCH FOR INTERNAL DIMENSIONS 18. 0' 25. 0' 40. 0'25.0' 40.0' 25.0'40.0'25.0'40.0'25.0'40.0'25.0' 40.0'25.0'40.0' 25.0'40.0'25.0'40.0'25.0'40.0' 25.0'18.0'9.0'25.0'24.0' 18.0'25.0'25.0'18.0'25. 0'36.0'30.0'36.0'36.0'18.0'18.0' 25.0'18.0'41.0'21.0'66.0'52.0'81.0' 24.0'15.0'28.0'24.0'6.7'9.5' TYP.24.0'9.5 15.2'20.0'8' BLACK ORNAMENTAL FENCE 8' BLACK ORNAMENTAL FENCE 5 D C B A 4321 2024 KIMLEY-HORN AND ASSOCIATES, INC.10101 REUNION PLACE, SUITE 400, SAN ANTONIO, TX 78216PHONE : 210-541-9166 FAX: 210-541-8699WWW.KIMLEY-HORN.COM TBPE FIRM NO. 928STORE# 6963-1006PREPARED FORWALMARTWAL-MART ANNA ADDITIONBLK A, LOT 1TEXASANNASITE PLANSITE PLAN DATA SITE NOTES 1.ALL WORK AND MATERIALS SHALL COMPLY WITH ALL CITY/COUNTY REGULATIONS AND CODES AND O.S. H.A. STANDARDS.2.CONTRACTOR SHALL REFER TO THE ARCHITECTURAL PLANS FOR EXACT LOCATIONS AND DIMENSIONS OF VESTIBULES, SLOPE PAVING, SIDEWALKS, EXIT PORCHES, TRUCK DOCKS,PRECISE BUILDING DIMENSIONS AND EXACT BUILDING UTILITY ENTRANCE LOCATIONS.3. ALL CURBED RADII ARE TO BE 3' OR 10' UNLESS OTHERWISE NOTED.4. ALL DIMENSIONS AND RADII ARE TO THE FACE OF CURB UNLESS OTHERWISE NOTED.5.EXISTING STRUCTURES WITHIN CONSTRUCTION LIMITS ARE TO BE ABANDONED, REMOVED OR RELOCATED AS NECESSARY. ALL COST SHALL BE INCLUDED IN BASE BID.6.CONTRACTOR SHALL BE RESPONSIBLE FOR ALL RELOCATIONS, (UNLESS OTHERWISE NOTED ON PLANS) INCLUDING BUT NOT LIMITED TO, Item No. 12. Planning & Zoning Commission Agenda Staff Report Meeting Date:12/2/2024 Staff Contact:Lauren Mecke AGENDA ITEM: Conduct a Public Hearing/Consider/Discuss/Action on an Ordinance to amend an existing Planned Development (Ord. No. 648-2014) to allow for a commercial drone delivery hub on 4,770± square feet, located on the west side of S. Buddy Hayes Boulevard, 265± feet north of W. White Street. Zoned Planned Development (Ord. No. 648-2014). (PD 24-0005) Owner: Matt Philpott (Walmart Sr. Project Manager) SUMMARY: A retail store building on one lot on 18.5± acres, on the west side of S. Buddy Hayes Boulevard, 265± feet north of W. White Street. Zoned Planned Development (Ord. 648- 2014). History: Ordinance No. 120-2003 – Annexed and zoned 98.2± acres to Planned Development with modified C-2 uses. December 9, 2003. Ordinance No. 121-2003 – Annexed and zoned 9.1± acres to Planned Development with modified C-2 uses. December 9, 2003. Ordinance No. 648-2014 - Rezoned by repeal of Ordinance No. 120-2003 and Ordinance No.121-2003 and replaced with Planned Development zoning with modified C-2 uses and standards. January 28, 2014. Case Overview The applicant is proposing to add a commercial drone delivery hub as an accessory use to the retail store. Staff mailed public hearing notices to surrounding property owners in accordance with state law. To date, Staff has not received any input comments on this case. Direction Land Use Zoning Comprehensive Plan North Vacant Zoned PD (Ord. 648- 2014) Regional Activity Center East Vacant lot and Hotel Zoned PD (Ord. 648- 2014) Urban Living South Four commercial/retail lots Zoned PD (Ord. 648- 2014) Regional Activity Center West Three restaurant and restaurant/retail lots Two zoned PD (Ord. 648-2014), and one zoned PD (Ord. 648- 2014 & Ord. 826-2019) Regional Activity Center Compatibility Considerations This request will not change the base zoning, Regional Commercial (C-2), of the Planned Development and is generally in conformance with the Anna 2050 Comprehensive Plan. The Zoning Ordinance does not currently address the emerging technology of drone delivery. Staff researched standards used by other Texas cities and are proposing the following: Restricting the outdoor storage location to the equipment area as shown on the site plan associated with this request. Restricting the area for outdoor storage to a maximum of 5,000 square feet. Establishing screening standards: o A minimum 8-foot-tall black ornamental screen with unobstructed view shall be provided around all outdoor storage areas.. Requiring additional landscaping to provide screening from the equipment: o . Additional trees within or adjacent to the landscape buffer shall be provided along Buddy Hayes Boulevard to create a screening effect of the commercial drone delivery hub equipment and must contain: One (1) canopy tree per 40 linear feet of street frontage and One (1) ornamental tree per 20 linear feet of fencing The applicant is not requesting to reduce or remove parking spaces from the site. Proposed location of the commercial drone delivery hub: Current aerial image and selection from site plan. STAFF RECOMMENDATION: Staff recommends approval as presented in the attached Ordinance. ATTACHMENTS: 1. Locator Map - Walmart Anna Addition, Block A, Lot 1 Zoning 2. Ordinance - Walmart Anna Addition, Block A, Lot 1 3. Exhibit A - Walmart Anna Addition, Block A, Lot 1, Legal Description 4.Exhibit B - Walmart Anna Addition, Block A, Lot 1, Site Plan Item No. 7.b. City Council Agenda Staff Report Meeting Date: 1/14/2025 Staff Contact: Gregory Peters AGENDA ITEM: Consider/Discuss/Action on a Resolution approving an Ordinance reducing the maximum prima facie speed limit on State Highway 5. (Assistant City Manager Greg Peters, P.E.) SUMMARY: This item is a new City Ordinance, setting the maximum prima facie speed limit on State Highway 5 in the City of Anna Texas in multiple locations. FINANCIAL IMPACT: This item has no financial impact. BACKGROUND: At the request of City staff, the Texas Department of Transportation recently completed a speed study of the State Highway 5 corridor from Hackberry Drive to County Road 1106. The study found that the speed limit should be reduced in three locations, including: Reduce speed limit from 55 mph to 50 mph from north of Slayter Creek middle school to Rosamond Parkway Reduce speed limit from Rosamond to County Road 371 from 60 to 55mph Reduce speed limit from County Road 371 to County Road 1106 from 65mph to 55mph If the Ordinance is adopted by the City Council, the revised speed limits from Hackberry Drive to County Road 1106 will be: Hackberry Drive to Rosamond Parkway: 50 mph Rosamond Parkway to County Road 1106: 55 mph North of County Road 1106: 65 mph The existing school zone location and school zone speed limit of 35 miles per hour in front of Slayter Creek Middle School will remain unchanged. City staff concurs with the findings of the speed study conducted by TxDOT; and finds the proposed reduction in speed limits to be necessary to address the increased traffic volume and turning movements in the SH5 corridor north of Hackberry Drive. STRATEGIC CONNECTIONS: This item supports the City of Anna Strategic Plan, specifically advancing the strategic outcome area: Safe. ATTACHMENTS: 1. Resolution - SH5 Speed Limits 2. Ordinance - State Highway 5 Speed Limits CITY OF ANNA, TEXAS RESOLUTION NO. _______________ A RESOLUTION OF THE CITY OF ANNA, TEXAS APPROVING AN ORDINANCE OF THE CITY OF ANNA, TEXAS, ALTERING THE PRIMA FACIE SPEED LIMITS ESTABLISHED FOR VEHICLES UNDER THE PROVISIONS OF TRANSPORTATION CODE, SECTION 545.356 UPON STATE HIGHWAY 5 OR PARTS THEREOF, WITHIN THE CORPORATE LIMITS OF THE CITY OF ANNA , WITH AN EFFECTIVE DATE. WHEREAS, the City of Anna, Texas (“the City”) is a home-rule municipality in Collin County, Texas; and, WHEREAS, the Texas Department of Transportation recently conducted an engineering and traffic investigation on State Highway 5 in the City of Anna, Texas, and; WHEREAS, the findings of the engineering and traffic investigation demonstrate that altering the prima facie speed limits for State Highway 5 is safe and reasonable, and; WHEREAS, Section 545.356 of the Texas Transportation Code, provides that whenever the governing body of a municipality shall determine upon the basis of an engineering and traffic investigation that any prima facie speed therein set forth is greater or less than is reasonable or safe under the conditions found to exist at any intersection or other place or upon any part of a street or highway within the municipality, taking into consideration the width and condition of the pavement and other circumstances on such portion of said street or highway, as well as the usual traffic thereon, said governing body may determine and declare a reasonable and safe prima facie speed limit thereat or thereon by the passage of an ordinance, which shall be effective when appropriate signs giving notice thereof are erected at such intersection or other place or part of the street or highway, and; NOW THEREFORE, BE IT RESOLVED BY THE CITY COUNCIL OF THE CITY OF ANNA, TEXAS, THAT: Section 1.Recitals Incorporated The recitals above are incorporated herein as if set forth in full for all purposes. Section 2.Authorization of Speed Zones. The City Council of the City of Anna, Texas, authorizes the Mayor to cause to be erected appropriate signs indicating such speed zones. PASSED AND APPROVED by the City Council of the City of Anna, Texas on this ___ day of January 2025. ATTEST: APPROVED: City Secretary, Carrie Land Mayor, Pete Cain Exhibit A following Page) CITY OF ANNA, TEXAS ORDINANCE NO. ____________ AN ORDINANCE OF THE CITY OF ANNA, TEXAS, ALTERING THE PRIMA FACIE SPEED LIMITS ESTABLISHED FOR VEHICLES UNDER THE PROVISIONS OF TRANSPORTATION CODE, SECTION 545.356 UPON STATE HIGHWAY 5 OR PARTS THEREOF, WITHIN THE CORPORATE LIMITS OF THE CITY OF ANNA, TEXAS, AS SET OUT IN THIS ORDINANCE; PROVIDING FOR A PENALTY; PROVIDING FOR SAVINGS, SEVERABILITY, AND REPEALING CLAUSES; PROVIDING FOR AN EFFECTIVE DATE; AND PROVIDING FOR THE PUBLICATION OF THE CAPTION THEREOF. WHEREAS, the City of Anna, Texas (“the City”) is a home-rule municipality in Collin County, Texas; and, WHEREAS, Section 545.356 of the Texas Transportation Code, provides that whenever the governing body of a municipality shall determine upon the basis of an engineering and traffic investigation that any prima facie speed therein set forth is greater or less than is reasonable or safe under the conditions found to exist at any intersection or other place or upon any part of a street or highway within the municipality, taking into consideration the width and condition of the pavement and other circumstances on such portion of said street or highway, as well as the usual traffic thereon, said governing body may determine and declare a reasonable and safe prima facie speed limit thereat or thereon by the passage of an ordinance, which shall be effective when appropriate signs giving notice thereof are erected at such intersection or other place or part of the street or highway; and, NOW, THEREFORE BE IT ORDAINED BY THE CITY COUNCIL OF THE CITY OF ANNA, TEXAS, THAT: Section 1.Recitals Incorporated. The above-referenced recitals are incorporated herein as if set forth in full for all purposes. Section 2.Engineering And Traffic Investigation. Upon the basis of an engineering and traffic investigation heretofore made as authorized by the provisions of Texas Transportation Code, Section 545.356, the following prima facie speed limits hereafter indicated for vehicles on the attached EXHIBIT “A” (speed zone map) and listed below: A maximum speed limit of 50 miles per hour is hereby determined and declared to be reasonable and safe; and such speed limit is hereby fixed at the rate of speed indicated for vehicles traveling upon the named streets and highways, or parts thereof, described as follows: the segment(s) of SH 5 within the City of Anna’s corporate limits extending from Hackberry Drive to Rosamond Parkway. A maximum speed limit of 55 miles per hour is hereby determined and declared to be reasonable and safe; and such speed limit is hereby fixed at the rate of speed indicated for vehicles traveling upon the named streets and highways, or parts thereof, described as follows: the segment(s) of SH 5 within the City of Anna’s corporate limits extending from Rosamond Parkway to County Road 1106. Section 3.Authorization The Mayor of the City of Anna, Texas is hereby authorized to cause to be erected appropriate signs indicating such speed zones. Section 4.Penalty. Any violation of any of the terms of this ordinance, whether denominated in this ordinance as unlawful or not, shall be deemed a misdemeanor. Any person convicted of any such violation shall be fined in an amount not to exceed $200 for each incidence of violation. Each violation is considered a separate offense and will be punished separately. Section 5.Savings, Severability and Repealing Clauses. All ordinances of the City in conflict with the provisions of this ordinance are repealed to the extent of that conflict. If any provision of this ordinance shall be held to be invalid or unconstitutional, the remainder of such ordinance shall continue in full force and effect the same as if such invalid or unconstitutional provision had never been a part thereof. The City declares that it would have passed this ordinance and each section, subsection, clause, or phrase thereof irrespective of the fact that any one or more sections, subsections, sentences, clauses, and phrases be declared unconstitutional ort invalid. Section 6.Publication of the Caption Hereof and Effective Date. This ordinance shall be in full force and effective from and after its passage and upon the posting and/or publication, if required by law, of its caption and the City Secretary is hereby directed to implement such posting and/or publication. PASSED AND APPROVED by the City Council of the City of Anna, Texas on this ___ day of ________ 2025. ATTEST: APPROVED: City Secretary, Carrie Land Mayor, Nate Pike Exhibit A Engineering and Traffic Investigation Item No. 7.c. City Council Agenda Staff Report Meeting Date: 1/14/2025 Staff Contact: Gregory Peters AGENDA ITEM: Consider/Discuss/Action on a Resolution authorizing the City Manager to execute an agreement with the Northpointe Crossing Homeowner's Association for the design and construction of drainage improvements for an unnamed tributary of Sweetwater Creek, approved as to form by the City Attorney. (Assistant City Manager Greg Peters, P.E.) SUMMARY: This item is for the City Council to consider entering into an agreement with the Northpointe Crossing Homeowner's Association for cost sharing and project management of the design and construction of drainage improvements for an existing drainage channel located in the Northpointe Crossing Subdivision, which is an unnamed tributary of Sweetwater Creek. FINANCIAL IMPACT: Funding for the Northpointe Drainage Project will come from a future budget amendment in the amount of $100,000 from the Stormwater Utility Fund. The estimated cost of the project is $200,000. The agreement includes a 50/50 cost share between the City and the Homeowner's Association. If both parties agree to execute the agreement, staff will bring the budget amendment to the City Council for approval prior to construction. BACKGROUND: The original development of the Northpointe Crossing Subdivision included changed to an existing drainage way which enters the neighborhood on the north side at County Road 1106, and traverses through the property to the southeast. The original developer made changes to the drainage, and constructed a defined earthen channel for stormwater to be conveyed downstream. The channel is located in a drainage easement on property owned by the Northpointe Crossing Homeowner's Association. Over time, the earthen channel has experienced erosion. Neighbors residing in the subdivision, including the President of the Northpointe Homeowner's Association, have requested for the City to assist in addressing the erosion in the channel. City staff has reviewed the conditions and has developed a concept plan and project budget for addressing the worst areas of erosion in the channel. If approved, the attached agreement would allow the City to move forward and work with the Homeowner's Association on a formal project to address the concerns. The agreement identifies the responsibilities of the City and the Homeowner's Association regarding the proposed project and future maintenance of the channel. STRATEGIC CONNECTIONS: This item supports the City of Anna Strategic Plan, specifically advancing the strategic outcome area: Resilient. ATTACHMENTS: 1. Resolution - Northpointe HOA Drainage Agreement 2. Final Draft - Northpointe Drainage Improvement Agreement CITY OF ANNA, TEXAS RESOLUTION NO. _______________ A RESOLUTION OF THE CITY OF ANNA, TEXAS AUTHORIZING THE CITY MANAGER TO EXECUTE A DRAINAGE IMPROVEMENT COST SHARING AGREEMENT BETWEEN THE CITY OF ANNA AND THE NORTHPOINTE CROSSING HOMEOWNER’S ASSOCIATION, SUBJECT TO APPROVAL AS TO LEGAL FORM BY THE CITY ATTORNEY, WITH AN EFFECTIVE DATE. WHEREAS, the Northpointe Crossing neighborhood is a single family residential neighborhood located in the City of Anna, Texas; and, WHEREAS, the Northpointe Crossing Homeowner’s Association is the owner of real property known as Lot 1: Common Area, and Lot 29, Block A, of Northpointe Crossing Phase 1 Subdivision, and; WHEREAS, the Northpoint Crossing Homeowner’s Association desires to improve the drainage conditions and remedy erosion along an existing drainage channel located on and across Lot 1: Common Area, and Lot 29, Block A, of Northpointe Crossing Phase 1 Subdivision, and; WHEREAS, the existing drainage channel is located in a drainage easement as shown on the final plat for the subdivision recorded in the Official Records of Collin County, Texas, File Number 20061208010005330, and; WHEREAS, the City and the Homeowner’s Association desire to enter into an agreement to share in the cost of the design and construction of the improvements for public benefit, and; WHEREAS, the Drainage Improvement Cost-Sharing Agreement identifies the responsibilities, terms, and conditions of both parties, and is attached hereto as Exhibit A,” and; NOW THEREFORE, BE IT RESOLVED BY THE CITY COUNCIL OF THE CITY OF ANNA, TEXAS, THAT: Section 1.Recitals Incorporated The recitals above are incorporated herein as if set forth in full for all purposes. Section 2.Authorization of Agreement and Funding. The City Council of the City of Anna, Texas, authorizes the City Manager to execute the attached Drainage Improvement Cost-Sharing Agreement, subject to approval as to legal form by the City Attorney. The City Council of the City of Anna, Texas, authorizes the City Manager to prepare a budget amendment to provide up to $100,000 in project funding from the Stormwater Utility Fund, said budget amendment to be brought forth for future City Council approval within 90 days of the execution of the agreement. PASSED AND APPROVED by the City Council of the City of Anna, Texas on this ___ day of January 2025. ATTEST: APPROVED: City Secretary, Carrie Land Mayor, Pete Cain Exhibit A following Page) 1 DRAINAGE IMPROVEMENT COST-SHARING AGREEMENT This Drainage Improvement Cost-Sharing Agreement (this “Agreement”), dated as of the _____ day of ____________________, 2025 (“Effective Date”), is made and entered into by and between the City of Anna, Texas, a home-rule municipality (the City”) and Northpointe Crossing Homeowners’ Association, Inc., a Texas nonprofit corporation (the “HOA”). WHEREAS, the HOA is the homeowners association for the developed subdivision known as Northpointe Crossing (the “Neighborhood”); and WHEREAS, the HOA is the sole owner of Lot 1: COMMON AREA, and Lot 29, Block A of Northpointe Crossing Phase 1 (the “HOA Property”); and WHEREAS, the HOA desires to improve the drainage conditions and remedy erosion along the existing drainage channel located on the HOA Property (the Drainage Project”); and WHEREAS, the Drainage Project is intended to improve drainage conditions and protect the slide slopes of the existing drainage channel in specific locations as depicted in Exhibit A, attached to this Agreement and incorporated herein by reference; and WHEREAS, the City has estimated that the cost of construction of the Drainage Project is $200,000 (the “Estimated Cost”); and WHEREAS, the HOA and the City desire to enter into this Agreement to share in the cost of said construction in order to facilitate and accelerate the construction of the Drainage Project in accordance with the terms of this Agreement; NOW, THEREFORE, for and in consideration of the covenants and conditions contained in this Agreement, the City and the HOA agree as follows: 1. The City shall manage all aspects of the design and construction of the Drainage Project. The Drainage Project shall be constructed in accordance with all applicable City regulations. 2. Before design and construction of the Drainage Project commences, the HOA shall provide to the City any necessary temporary construction easements and rights of entry to allow for construction of the Drainage Project. The HOA will further grant temporary workspace or laydown areas on and across the HOA Property as may be required to construct the Drainage Project. 3. Before design and construction of the Drainage Project commences, the City shall seek to obtain any necessary temporary construction 2 easements and/or rights of entry on single family residential properties adjacent to the Drainage Project, to allow for construction of the Drainage Project. The Parties agree that the City shall not be obligated to pay for such temporary access easements and/or rights of entry, as the Drainage Project is specifically intended to provide benefit to the adjacent single family residential properties and the Neighborhood. Should the City be unable to obtain the temporary construction easements and rights of entry on single family properties adjacent to the Drainage Project, both Parties agree that the construction scope shall be modified to remove such portions of the project which require said temporary construction easements and/or rights of entry. 4. The City and the HOA hereby acknowledge that while there are numerous existing private fences located along the limits of the Drainage Project, it shall be considered a Force Majeure event to the extent that any existing fence falls, is damaged, or otherwise made inoperable by weather conditions, natural decay, or acts of others during the time period between commencement and completion of construction. The City will be responsible for the replacement, repair, and/or removal of any existing fences located adjacent to the Drainage Project which were specifically damaged by the direct actions of construction workers or City staff during the construction process. Should said replacement, repair, and/or removal of any fence be necessary during the construction process, the City shall complete said replacements, repairs, and removals in such a way as to meet the pre- construction conditions of the fence. 5. The City and the HOA will share in the cost of the Drainage Project. The HOA will deposit with the City the cash sum of $100,000, which is 50% of the Estimated Cost. Said deposit must be made before commencement of the design and construction of the Drainage Project. The City agrees to use said deposited funds solely for the costs of the design and construction of the Drainage Project. The City shall have no obligations under this Agreement until said cash deposit has been received by the City. 6. The City shall commence construction of the Drainage Project within 120 days after the date that the HOA makes the deposit referenced above. The City shall complete the Drainage Project within 180 days after the deadline to commence construction. 7. Upon completion of the Drainage Project the City shall provide the HOA with evidence of the actual cost paid by the City for the design and construction of the Drainage Project (the “Actual Cost”). If the Actual Cost exceeds the Estimated Cost, the HOA shall pay the City the cash 3 sum that is equal to 50% of the amount of the Actual Cost that exceed the Estimated Cost and such payment shall be due within 30 days of the City providing the HOA with proof of the Actual Cost. If the Actual Cost is less than the Estimated Cost, the City shall pay the HOA the cash sum that is equal to 50% of the amount of Estimated Cost that exceed the Actual Cost and such payment shall be due within 30 days of the City providing the HOA with proof of the Actual Cost. 8. Upon completion of the Drainage Project, the HOA will permanently maintain the completed Drainage System in a manner similar to the other public Drainage Systems on HOA-owned property in the Neighborhood, in compliance with City of Anna Code of Ordinances. The City shall not maintain nor be responsible in any manner for operation or maintenance of any portion of the HOA Property. 9. This Agreement is intended solely for the benefit of the parties hereto and does not confer any rights on any person or entity not a party to this Agreement, nor does it create any third-party beneficiaries to this Agreement. 10. Any agreement, notice, correspondence, information and/or other documentation required and/or referred to in this Agreement shall be in writing. This Agreement may not be amended and/or modified except on written consent of the party thereto. Except as expressly set forth herein, this agreement does not commit the parties to any future obligations. 11. Waiver by either party of any breech of this Agreement affecting such party, or the failure of either party to enforce any of the provisions of this Agreement, shall not in any way affect, limit or waive such party’s right thereafter to enforce and compel strict compliance. 12. No party shall be in default under this Agreement until written notice of the default has been given to the defaulting party (which notice shall describe in reasonable detail the nature of the default) and the defaulting party has been given thirty (30) calendar days to cure said default. If a party is in default under the Agreement, the non-defaulting party may, as its sole remedy, seek specific performance. 13. This Agreement constitutes the entire agreement between the parties and supersedes all prior agreements, whether oral or written, covering the same subject matter. This Agreement may not be modified or amended except in writing mutually agreed to and accepted by the parties. 4 14. The Agreement shall be construed in accordance with Texas law without regard to its conflict of laws and provisions. 15. Venue for any action arising hereunder shall be in Collin County, Texas. 16. Any notice or other communication required by this Agreement to be given, provided, or delivered shall be in writing addressed as set forth below. Notices shall be considered given or provided for purposes of this Agreement: (a) if by Certified Mail, five (5) business days after deposited with the U.S. Postal Service, Certified Mail, Return Receipt Requested; or (b) if by private delivery service (e.g. FedEx or UPS), on the date delivered to the notice address as evidenced by a receipt signed by any person at the notice address. If intended for City: City of Anna Attention: City Manager 120 W. 7th Street Anna, TX 75409 With a copy to: Wolfe, Tidwell & McCoy, LLP Attention: Clark McCoy 2591 Dallas Pkwy, Ste 300 Frisco, TX 75034 If intended for the HOA: ______________________ 17. Each party has the right to change, from time to time, its notice addresses by giving at least ten (10) business day’s written notice to the other party. If any time period provided in this Agreement ends on a Saturday, Sunday, or legal holiday, the period shall be extended to the first business day following such Sunday, Saturday, or legal holiday. 18. The recitals contained in this Agreement: (a) are true and correct as of the Effective Date; (b) form the basis upon which the parties negotiated and entered into this Agreement; and (c) reflect the final intent of the parties with regard to the subject matter of this Agreement. If it becomes necessary to interpret any provision of this Agreement, the intent of the parties, as evidenced by the recitals, shall be given full effect. The parties have relied, to their material detriment, upon the 5 recitals as part of the consideration for entering into this Agreement and, but for the recitals, would not have entered into this Agreement. 19. This Agreement may be executed in any number of counterparts, each of which shall be deemed an original and constitute one and the same instrument. A facsimile signature will also be deemed to constitute an original if properly executed. 20. The individuals executing this Agreement on behalf of the respective parties below represent to each other that all appropriate and necessary action has been taken to authorize the individual who is executing this Agreement to do so for and on behalf of the party for which his signature appears, that there are no other parties or entities required to execute this Agreement in order for the same to be an authorized and binding agreement on the party for whom the individual is signing this Agreement and that each individual affixing his signature hereto is authorized to do so, and such authorization is valid and effective on the date of this Agreement. 21. The parties agree that they have not waived any respective sovereign immunity by entering into and performing their respective obligations under this Agreement. 22. This Agreement is not assignable. 23. Each signatory represents this Agreement has been read by the party for which this Agreement is executed and that such party has had the opportunity to confer with its counsel. 24. In case any one or more of the provisions contained in this Agreement shall for any reason be held to be invalid, illegal or unenforceable in any respect, such invalidity, illegality, or unenforceability shall not affect any other provision thereof, and this Agreement shall be construed as is such invalid, illegal, or unenforceability provision had never been contained herein. 25. This Agreement shall be deemed drafted equally by the parties hereto. The language of all parts of this Agreement shall be construed as a whole according to its fair meaning, and any presumption or principle that the language herein is to be construed against either party shall not apply. IN WITNESS WHEREOF, the parties have executed this Agreement and caused this Agreement to be effective on the Effective Date. 6 CITY OF ANNA, TEXAS By: ____________________________________________________ Ryan Henderson, City Manager STATE OF TEXAS COUNTY OF COLLIN Before me, the undersigned authority, on this day personally appeared Jim Proce known to me to be one of the persons whose names are subscribed to the foregoing instrument; he acknowledged to me that he is the duly authorized representative of and for the CITY OF ANNA, TEXAS, a Texas political subdivision, and he executed the said instrument for the purposes and consideration therein expressed and in the capacity therein stated. Given under my hand and seal of office this _______ day of ________________, 2025. Notary Public in and for the State of Texas My Commission Expires: 7 NORTHPOINTE CROSSING HOMEOWNERS’ ASSOCIATION, INC. By: ____________________________________________________ Robert Sell, its President STATE OF TEXAS COUNTY OF COLLIN Before me, the undersigned authority, on this day personally appeared Kelly Patterson-Herndon, known to me to be one of the persons whose names are subscribed to the foregoing instrument; she acknowledged to me that she is the duly authorized representative of and for Northpointe Crossing Homeowners’ Association, Inc., a Texas nonprofit corporation, and she executed the said instrument for the purposes and consideration therein expressed and in the capacity therein stated. Given under my hand and seal of office this _______ day of ________________, 2025. Notary Public in and for the State of Texas My Commission Expires: 8 Exhibit A – Final Plat 9 Exhibit B – Project Location Map 10 Exhibit C – Concept Design 11 Exhibit D – Cost Estimate Item No. 7.d. City Council Agenda Staff Report Meeting Date: 1/14/2025 Staff Contact: Dalan Walker AGENDA ITEM: Consider/Discuss/Action on a Resolution approving an amendment to Master Agreement for Professional Services 2021-2026 with Freese & Nichols, Inc. with a Professional Services Project Order (PSPO) for planning work associated with an update to the park system master plan. (Park Planning and Development Manager, Dalan Walker, RLA) SUMMARY: Freese & Nichols, Inc. was selected to update the City's Anna 2050 Parks, Open Space, Trails and Recreation Master Plan. The project will include several meetings with neighbors and community partners, three meetings with the Parks Advisory Board and two presentations to City Council. There will also be an online survey similar to the one used for the library project. The project is expected to take 11 months and will begin the beginning of March. FINANCIAL IMPACT: Funding for the 2025 park master plan update was appropriated in the FY2025-2029 Community Investment Program budget in the amount of $350,000 from the Park Development Fund. The estimated cost of this service contract is $128,728 which includes two additional optional meetings at the discretion of the City. BACKGROUND: The Anna 2050 Parks, Open Space, Trails and Recreation Master Plan was adopted by City Council on April 27, 2021. Typically, park master plans are updated every five to seven years so that the evolving recreational needs of the community are considered and accounted for. Though it has been less than four years since adoption, Anna's unprecedented growth and changing demographics warrant an update. In addition, many of the projects specifically identified in current park master plan have been completed or are underway, including the skatepark, pickleball courts, trail segments and Bryant Park. Finally, some of the larger projects envisioned in the current plan are ready for refinement through additional public input. The two most significant projects for future consideration are a recreation center and a sports complex. An update to the Master Plan will be utilized to receive up-to-date feedback from the community, appointed officials, and elected officials, identify new and changing community needs, re-prioritize the remaining projects identified in the current plan. Freese & Nichols (FNI) was selected as the consultant to deliver an update to the park master plan based on their experience with park planning. They have a dedicated planning department that has completed dozens of park master plans for other municipalities. FNI is a large firm with sufficient resources to take the City's primary park planning tool to the next level. STRATEGIC CONNECTIONS: This item supports the City of Anna Strategic Plan, specifically advancing the strategic outcome area: Active. ATTACHMENTS: 1. Anna PSPO PARKS1 Freese Nichols FINAL - SIGNED 2. Resolution for PSPO PARKS1 with Freese & Nichols for Park Master Plan Update JAN 2025 Master PSA PSPO #PARKS1 Professional Service Project Order #PARKS1 Pursuant to and subject to the referenced Master Agreement for Professional Services (Master PSA), between the City and Firm, City hereby requests that Firm perform, and Firm agrees to perform, the work described below upon the terms and conditions set forth in said Master PSA, which are incorporated herein by reference for all purposes, and in this Professional Service Project Order (PSPO). MAPES # MASTER PSA CATEGORY: F-Landscape Archiecture and Park Planning ANNA PROJECT CODE: FIRM NAME Freese and Nichols, Inc. (FNI) Project Name: Park System Master Plan Update 2025 Consultant Project #: of Consecutive Business Days to Complete Project: 300 Original Project Fee: $124,600 OWNER OPTIONAL INFORMATION: 1. Date and Time to Commence: Upon Receipt of Signed Professional Services Project Order, City’s purchase order and Notice to Proceed 2. Other: Architectural Barrier Requirements: Yes ___ No X INVOICE SUBMITTAL Billing Period: Monthly-Through the end of each month, billed by the 10th of the following month. Invoice Mailing Instructions: Mail to: City of Anna Attn: Joanna Golleher 120 W 7th St Anna, TX 75409 Include work order number, PO number, billing period, and project name. Master PSA PSPO #PARKS1 Documents: The “PSPO DOCUMENTS” as that term is used herein, shall mean and include the following documents, and expressly incorporates the following by reference for all purposes. A. Master Agreement for Professional Services 2021-2026, effective September 8, 2021; and B. This Professional Services Project Order (PSPO) #PARKS1; and C. Scope of Services and Responsibilities of Owner-City of Anna Parks, Recreation, Open Space and Trails Master Plan Update This PSPO shall incorporate the terms of all the documents in their entirety. To the extent that there are any conflicts with provisions of the Master PSA, this PSPO or each other, the provisions of the Master PSA, then the provisions of this PSPO shall prevail in that order. Scope of Services: Reference proposal, attached hereto as Exhibit C. Schedule of Work and Completion Deadline: Work will take eleven (11) months. Acceptance: The individuals executing this Agreement on behalf of the respective parties below represent to each other that all appropriate and necessary action has been taken to authorize the individual who is executing this Agreement to do so for and on behalf of the party for which his or her signature appears, that there are no other parties or entities required to execute this Agreement in order for the same to be an authorized and binding agreement on the other party for whom the individual is signing this Agreement and that each individual affixing his or her signature hereto is authorized to do so, and such authorization is valid and effective on the date hereof. CITY OF ANNA, TEXAS FREESE AND NICHOLS, INC. Signature Signature Ryan Henderson - City Manager Clayton C. Barnard – Principal / Vice President Printed Name & Title Printed Name & Title Date Date January 8, 2025 Page 1of 6 CITY OF ANNA PARKS, RECREATION, OPEN SPACE, AND TRAILS MASTER PLAN UPDATE SCOPE OF SERVICES AND RESPONSIBILITIES Of OWNER ARTICLE I 1.PROJECT DESCRIPTION Freese and Nichols, Inc. (“FNI”) will perform professional planning and design services for the City of Anna Client”) by preparing a Parks, Recreation, Open Space, and Trails Master Plan. It is expected that this work will take 11 months starting in March 2025, following the contract signing by the Client. The citywide Parks, Recreation, Open Space, and Trails Master Plan Update will include an introduction and community analysis, parks and recreation inventory, identification of vision and goals, needs assessment, and recommendations for existing and future parks, recreation, and open space desires. The study area will encompass the entire City limits. Homeowners Association (HOA) parks will be included in the inventory but will be listed separately from public parks, and recommendations will not be created for the HOA parks. City parks that will be included in the basic inventory and assessment are listed below. 1.Baldwin Park 2.Bryant Park 3.Geer Park 4.Henry Clay “Yank” Washington Park 5.Hassie Lawrence Morgan Park 6.John Flavel Greer Park 7.Anna Crossing Park 8.Carol Park 9.Johnson Park 10.Natural Springs Park 11.Sherly Heritage Park 12.Slayter Creek Park The final deliverable will meet the criteria established by the Texas Parks and Wildlife Department for Parks, Recreation, Open Space, and Trails Master Plans. EXHIBIT C Page 2 of 6 II. SCOPE OF SERVICES PARKS, RECREATION, OPEN SPACE, AND TRAILS MASTER PLAN UPDATE Module 1: Project Initiation Task 1A: Project Initiation FNI will conduct an initiation conference call and virtual presentation with key City staff. The purpose of the meeting will be to review the project scope; schedule; communication; expectations; deliverables; City and Consultant tasks, and confirmation of a Steering Committee to guide the creation of the Parks Plan (based on prior conversations, is it understood that that the Parks Board will serve as the Steering Committee for this process). Additionally, this meeting will discuss existing plans and facilities and any key information FNI should be aware of going into the Parks Board and stakeholder meetings. Task 1B: Document Template and Layout FNI will use the same template for the Parks Plan as was created for the Land Use Plan in Phase 1. Module 1 Deliverables: Prep for and conduct meetings described; Document template Module 2: Analysis & Inventory Task 2A: Stakeholder Interviews (virtual) FNI will conduct up to five (5) 45-minute meetings with key stakeholders as identified by the City. Task 2B: Public Survey FNI will develop an online survey to poll citizens on questions relevant to the Parks Plan as agreed to by the City. The survey questions will attempt to identify the parks and recreation vision, recreational issues, opportunities and needs, and key desires. FNI will provide a survey weblink to the City, and the City will be responsible for providing interface with the existing City website. This does not include a statistically valid survey, if desired, an outside survey firm could be brought in for an additional cost. Task 2C: Introduction & Community Analysis FNI will prepare an introduction chapter to the report to summarize the purpose of the plan, the benefits of parks and recreation, and a brief history and description of the City, location, and context. FNI will prepare a community context chapter. The chapter will document and analyze the city’s demographic profile and previous planning efforts to understand user groups and establish a basis for park standards and future demands. Items to be included in the report may include historic and projected populations, growth areas, age distribution, race and ethnicity, educational attainment, employment, and economics. FNI will duplicate this information from the Future Land Use Plan as feasible and agreed to by the City. Based on the results of the public input, FNI will draft a vision with accompanying goals that reflect the community’s values and desires. Page 3 of 6 Task 2D: Parks Inventory City staff will provide baseline parks and recreation data including park and facility names, locations, acreages, lists of amenities, and list of programs. FNI will provide questionnaires and spreadsheets to City staff during project initiation to facilitate this data gathering. FNI will conduct an inventory tour and site reconnaissance to document park and facility conditions of the City’s parks and facilities. City staff may facilitate the tour or provide the team with information they can use for a self-guided tour. FNI will prepare a parks and recreation inventory chapter to document the following: current parkland size, location and classification; quantity and condition of equipment and amenities; and identification of recreation programs to create a snapshot of the current parks and recreation system. This data will be used as the basis for the Needs Assessment. Module 2 Deliverables: Prep for and conduct meetings described,- Conduct public survey and share results with City; Create draft chapters (Introduction & Community Analysis and Parks Inventory.) Module 3: Parks Assessment Task 3A: Parks Assessment FNI will conduct demand-based, standards-based, and resource-based needs assessments to analyze parkland location, quantity, and amenities. Public input will be summarized in the demand- based assessment. FNI will develop target levels of service for parkland acreage, trail corridors and linkages, and other amenities that are right-sized for the City of Anna and its Extraterritorial Jurisdiction (ETJ). Levels of service will be based on current population and future population projections from the Community Analysis. Task 3B: Summary of Needs FNI will present a summary identifying noted needs in the City’s parks network and recreational programming, based on the findings of the Parks Assessment. These needs will be addressed in the recommendations. Task 3C: Public Open House FNI and the City will conduct a public open house to allow residents to respond to the needs assessment and provide further input that can influence the recommendations. Task 3D: Parks Board Meeting #1 FNI will conduct a meeting with the City’s Parks Board to present and get feedback on the outcomes of this work phase. Task 3E: Parkland Dedication Fees & Fee In Lieu Analysis FNI will conduct an analysis on the current parkland dedication fees and fees in lieu of parkland dedication. FNI will research peer cities to understand industry standards for fees. FNI will generate recommendations for updates and improvements to fees. Module 3 Deliverables: Prep for and conduct meetings described; Create draft Parks Assessment chapter. Page 4 of 6 Module 4: Recommendations & Implementation Task 4A: Recommendations FNI will draft a recommendations chapter based on the outcomes of the public input and the needs assessment. Recommendations may include land acquisition and development of new parks, enhancements and upgrades to existing parks, recreational programming, high-level trails master plan, and partnerships and funding opportunities. Recommendations will include the identification of new regional-level park(s) and a city-wide trails plan. Task 4B: Implementation Plan FNI will develop an Implementation Plan. Based on community and City staff feedback, recommendations will be prioritized into an implementation action plan to include initiation time frames and planning level potential cost ranges. Task 4C: Parks Board Meeting #2 FNI will conduct a meeting with the City’s Parks Board to present and get feedback on the outcomes of this work phase. Module 4 Deliverables: Prep for and conduct meetings described; Create draft chapters (Recommendations and Implementation Plan). Module 5: Adoption & Finalization Task 5A: Draft Plan FNI will update the draft chapters based on feedback received up to this point, both from the community and client, and will generate a full draft plan for adoption consideration. FNI will undertake one round of revisions to the draft plan based on City comments, the client shall provide consolidated comments using a comment log provided by FNI. This will be the final draft plan for consideration. Task 5B: Parks Board Meeting #3 — Boards & Commissions Recommendation FNI will attend (1) meeting for the presentation of the Plan to a joint meeting of the Parks Board and any other Boards & Commissions that need to provide a recommendation on the proposed Parks Plan. FNI will not make updates to the plan between this meeting and the City Council meeting. Boards & Commissions recommendations and comments will be provided to City Council along with the draft plan in the same form it was provided to Boards & Commissions. Task 5C: Plan Adoption Meeting — City Council FNI will attend (1) meeting for the presentation and consideration of the Plan by City Council. Task 5D: Finalization of Deliverables The Client will provide consolidated final comments using a comment log provided by FNI. FNI will revise the plan and provide a final document tor adoption. At this point, it is assumed that the plan adoption is on consent and FNI will not attend the City Council meeting. FNI will create the plan using Adobe InDesign. FNI will provide the City with the following deliverables: Digital PDF version of the final plan document, which can be used in a variety of ways by the city, including web and print. CD containing all working electronic files for the report, including the packaged InDesign files, digital versions of all chart, tables, maps, graphics, etc, GIS shape files, and other electronic data developed during the planning process. Page 5 of 6 III.COMPENSATION FNI shall perform professional services as outlined in ARTICLE I for a total not to exceed amount of 124,600. ARTICLE II ADDITIONAL SERVICES: Additional Services to be performed by Consultant, if authorized by City, which are not included in the above described basic services, are described as follows: A.Up to two (2) additional meetings at the City’s discretion at a cost of $2,064 per meeting. B.Printing and binding of documents in addition to those identified in ARTICLE II will be billed in accordance with the rates outlined in Exhibit C. Consultant, following a request for assistance from the City, will prepare an estimate for approval by the City prior to initiating work. C.Making revisions to drawings or other report documents when such revisions are 1) not consistent with approvals or instructions previously given by City or 2) due to other causes not solely within the control of Consultant. D.Meeting or trips in excess of the number of meetings included in Article I for coordination meetings, public meetings or other activities. Additional meetings requested by the City in excess of those included in Article I will be billed hourly in accordance with the rates outlined in Attachment CO. E.Preparation of new impact fees or impact fee updates for water, wastewater, roadway or drainage under Chapter 395. F.Preparation or revisions to engineering criteria manuals and development manuals. G.Preparation or revisions to the zoning map, such as zoning map amendments. H.Preparation of water, wastewater or drainage master plans, or updates to other adopted plans. I.Preparing applications and supporting documents for government grants, loans, or planning advances and providing data for detailed applications, including MPO applications. J.Preparing data and reports for assistance to City in preparation for hearings before regulatory agencies, courts, arbitration panels or any mediator, giving testimony, personally or by deposition, and preparations therefore before any regulatory agency, court, arbitration panel or mediator. K.Revisions, contract modifications, studies or analysis required to comply with local, State, Federal or other regulatory agencies that become effective after the date of this agreement. L.Providing basic or additional services on an accelerated time schedule. This includes cost for overtime wages of employees and Consultants, inefficiencies in work sequence and plotting or reproduction costs directly attributable to an accelerated time schedule directed by the City. M.Preparing statements for invoicing or other documentation for billing other than for the standard invoice for services attached to this professional services agreement. N.Providing document revisions in excess of those outlined in Article I. ARTICLE III TIME OF COMPLETION: Consultant is authorized to commence work on the Project upon execution of this Agreement and agrees to complete the basic services within eight (8) months of the notice to proceed, with three (3) additional months to account for the adoption process, totaling eleven (11) months. If Consultant’s services are delayed through no fault of FNI, FNI shall be entitled to adjust contract schedule consistent with the number of days of delay. These delays may include but are not limited to delays in City or regulatory reviews, delays on the flow of information to be provided to FNI, governmental approvals, etc. These delays may result in an adjustment to compensation as outlined on the face of this Agreement and will be based upon rates outlined in Attachment CO. ARTICLE IV RESPONSIBILITIES OF OWNER: City shall perform the following in a timely manner so as not to delay the services of Consultant: A.Provide meeting space and coordinate equipment needs, room set up, and logistics for meetings outlined in Article I. B.Provide information from all previous and current studies and projects (as available) that may affect the outcome of the Project. This information will be provided in digital format when possible and available. C.Provide any identified issues known to City Staff. D.Provide the most recently updated digital base map and aerial imagery of the planning area for use during the comprehensive plan preparation process. These files will be in the form of GIS file types native to ESRI ArcGIS. E.Contact meeting invitees for stakeholder and public meeting(s). This includes email, mail, newsletter or other forms of notification. F.Examine and provide prompt feedback on all submittals, draft reports, sketches, drawings, and other documents presented by Consultant within a reasonable time so as not to delay the services of Consultant. City comments should be consolidated with clear and concise edits, preferably typed for legibility. G.Designate in writing a person to act as City’s representative with respect to the services to be rendered under this Agreement. Such person shall have contract authority to transmit instructions, receive information, interpret and define City’s policies and decisions with respect to FNI’s services for the Project. H.Arrange for access to and make all provisions for FNI to enter upon public and private property as required for FNI to perform services under this Agreement. I.Bear all costs incidental to compliance with the requirements of this Article IV. ARTICLE V DESIGNATED REPRESENTATIVES: FNI designates the following representatives: City of Anna Representative FNI’s Project Representative Name: Wilson Kerr E-mail: Wilson.kerr@freese.com Phone: 469-249-0618 FNI’s Accounting Representative Name: Stephanie Kirchstein E-mail: Stephanie.kirchstein@freese.com Phone: 214-217-2212 CITY OF ANNA, TEXAS RESOLUTION NO. _________________ A RESOLUTION OF THE CITY OF ANNA, TEXAS, APPROVING A PROFESSIONAL SERVICES PROJECT ORDER FOR PLANNING SERVICES RELATED TO A PARK SYSTEM MASTER PLAN UPDATE. WHEREAS, the City Council of the City of Anna, Texas, (“City Council”) finds that the professional services project order (PSPO) #PARKS1 with Freese & Nichols, Inc. is instrumental and necessary to an update of the park system master plan; and WHEREAS, PSPO #PARKS1 amends Master Services Agreement 2021-2026 with Freese & Nichols executed on September 8, 2021; and WHEREAS, the City Council considers updating the park system master plan to be beneficial to the neighbors of Anna, Texas, meeting several goals and objectives set forth in the Strategic Plan adopted by City Council; and WHEREAS, the City Council approves PSPO #PARKS1 to include the following fee: The total amount for fiscal year 2025: $128,728.” NOW THEREFORE, BE IT RESOLVED BY THE CITY COUNCIL OF THE CITY OF ANNA, TEXAS, THAT: Section 1. Recitals Incorporated. The recitals above are incorporated herein as if set forth in full for all purposes as set forth in full. Section 2. Approval and Authorization of Agreement. The City Council hereby approves the extension attached hereto as Exhibit 1 to execute a PSPO that amends Master Services Agreement 2021-2026 with Freese & Nichols and ratifies and approves the City Manager’s execution of the same. The City Manager is hereby authorized to execute all documents and to take all other actions necessary to finalize and enforce the PSPO with Freese & Nichols. PASSED, APPROVED, AND ADOPTED on first and final reading on this 14th day of January, 2025. ATTEST: APPROVED: City Secretary, Carrie Land Mayor, Pete Cain Item No. 8.d. City Council Agenda Staff Report Meeting Date: 1/14/2025 Staff Contact: AGENDA ITEM: Discuss or deliberate personnel matters (Tex. Gov’t Code §551.074). City Council. SUMMARY: FINANCIAL IMPACT: BACKGROUND: STRATEGIC CONNECTIONS: ATTACHMENTS: