Loading...
The URL can be used to link to this page
Your browser does not support the video tag.
Home
My WebLink
About
12-02-2024 P&Z Meeting Packet
Persons with a disability who want to attend this meeting who may need assistance should contact the City Secretary, at 972-924-3325 two working days prior to the meeting so that appropriate arrangements can be made. AGENDA PLANNING AND ZONING COMMISSION Monday, December 2, 2024 @ 6:00 PM Council Chambers at the City of Anna Municipal Complex, located at 120 W 7th Street, Anna, TX 75409 The Planning & Zoning Commission of the City of Anna will meet on 12/02/2024 at 6:00 p.m. in the Council Chambers at the City of Anna Municipal Complex, to consider the following items. If you wish to speak on an Open Session agenda item, please fill out the Speaker Registration Form and turn it in to city staff before the meeting starts. 1.Call to Order, Roll Call, and Establishment of Quorum. 2.Invocation and Pledge of Allegiance. 3.Neighbor Comments: At this time, any person may address the Planning & Zoning Commission regarding an item on this meeting Agenda that is not scheduled for public hearing. Also, at this time, any person may address the Commission regarding an item that is not on this meeting Agenda. Each person will be allowed up to three (3) minutes to speak. No discussion or action may be taken at this meeting on items not listed on this Agenda, other than to make statements of specific factual information in response to a neighbor’s inquiry or to recite existing policy in response to the inquiry. 4.Director's Report 5.Location Map Consent Items 6.Approve Minutes of the November 4, 2024, Planning & Zoning Commission Meeting 7.Approve a Resolution regarding the AVC Addition, Block A, Lot 1, Preliminary Plat (PP 24-0015) Owner: Walker Morreng LLC/Clinton Walker 8.Approve a Resolution regarding the Freestone Anna Phase 2, Preliminary Plat. (PP 24- 0014) Owner: 615 Foster Crossing Investment LLC 9.Approve a Resolution regarding the G2 Motorsports, Minor Plat. (MP 24-0003) Owner: Lou Gigliotti 10.Approve a Resolution regarding the RJ Addition, Block A, Lots 1 & 2, Final Plat. (FP 24-0016) Owner: Randle Jones Items for Individual Consideration 11.Consider/Discuss/Action on a Resolution regarding the Sundstrom Addition, Block A, Lots 1 & 2, Replat (RP 24-0004) Owner: Dave Sundstrom 12.Conduct a Public Hearing/Consider/Discuss/Action on an Ordinance to amend an existing Planned Development (Ord. No. 648-2014) to allow for a commercial drone Persons with a disability who want to attend this meeting who may need assistance should contact the City Secretary, at 972-924-3325 two working days prior to the meeting so that appropriate arrangements can be made. delivery hub as an accessory use, located on the west side of Buddy Hayes Boulevard, 265± feet north of W. White Street. Zoned Planned Development (Ord. No. 648-2014). PD 24-0005) Owner: Matt Philpott (Walmart Sr. Project Manager) 13.Consider/Discuss/Action on a Resolution regarding the Walmart Anna Addition, Block A, Lot 1, Site Plan (SP 24-0007) Owner: Matt Philpott (Walmart Sr. Project Manager) Adjourn This is to certify that I, Lauren Mecke, Planning Manager, verify that this agenda was posted on the City's website (www.annatexas.gov) and at the Anna Municipal Complex bulletin board at or before 6:00 PM 11/27/2024. Lauren Mecke Planning Manager W FOSTER CROSSING RD C O UNTY ROAD 373 W WHITE ST E FM455SFERGUSONPKWY FM 2862 HACKBE R R Y DR E WHITE ST E FOSTER CROSSING RD W ROSAMOND PKWY W FM 455 E OUTER LOOP RD SAM R A Y B U R N H W Y W OUTER LOOP RD NPOWELLPKWYSPOWELLPKWYSAM RAY B U R N ME M O RIAL H WY 5 121 75 12- 13 1110 8 7 9 City of Anna, December 2, 2024 Planning & Zoning Meeting Map Source: City of Anna GIS Date: 11/ 25/2024 DISCLAIMER: This map and information contained in it were developed exclusively for use by the City of Anna. Any use or reliance on this map by anyone else is at that party' s risk and without liability to the City of Anna, its officials or employees for any discrepancies, errors,or variances whichmayexist.Document Path: <LINK>C:\Users\cbrooks\OneDrive</LINK> - City of Anna\GIS\Notification Maps\P&Z Overview Maps\P&Z Overview Maps.aprx 0 1 2 Miles´Agenda Items City Limits ETJ Parcels 1: MINUTES PLANNING AND ZONING COMMISSION November 4, 2024 The Planning and Zoning Commission of the City of Anna held a meeting at 6:00 p.m. on November 4, 2024, at the Municipal Complex located at 120 W. 7th Street, to consider the following items. 1. Call to Order and Establishment of Quorum The meeting was called to order at 6:00 p.m. Commissioners present were Jessica Walden, Staci Martin, Josh Vollmer, Tom Longmire, Doug Hermann, Commissioner Nylec, and Commissioner Blanscet. Staff present were Lauren Mecke, Everett Johnson, and Stephanie Scott-Sims, also in attendance were Mayor Pete Cain, & Councilwoman Kelly Patterson- Herndon. 2. Invocation and Pledge of Allegiance Commissioner Blanscet gave the invocation and led the Pledge of Allegiance. 3. Citizen Comments: At this time, any person may address the Planning and Zoning Commission regarding an item on this meeting agenda that is not scheduled for a public hearing. Also, at this time any person may address the Commission regarding an item that is not on this meeting agenda. Each person will be allowed up to three (3) minutes to speak. No discussion or action may be taken at this meeting on items not listed on this agenda, other than to make statements of specific factual information in response to a citizen’s inquiry or to recite existing policy in response to the inquiry. There were no Citizen comments. 4. Reports a. Director’s Report on City Council actions Mrs. Scott-Sims gave a brief recap of the previous Council Meeting on 10/22/2024, Mrs. Scott-Sims informed the Commissioners that the Rezone of 910 N. Powell from Single Family Residential to Commercial was approved by Council with a 7-0 vote. Mrs. Scott-Sims provided Commissioners with a draft schedule of upcoming meetings and updated the Commission on re-appointments and new Commissioners. 5. Location Map Consent Items A motion was made by Commissioner Hermann, seconded by Commissioner Martin to recommend approval of consent items # 6-12. Motion Passed. The vote was unanimous. 6. Approve Minutes of the October 7, 2024, Planning & Zoning Commission Meeting 7. Approve a Resolution regarding the Anna Retail Addition, Block A, Lot 8 and Block B, Lot 1, Site Plan, SP 24-0006 8. Approve a Resolution regarding the Anna White Street Addition, Block A, Lots 1-3, Conveyance Plat, CVP 24-0005 9. Approve a Resolution regarding the Blacklock Storage, Block A, Lot 1, Site Plan, SP 24-0005 10. Approve a Resolution regarding the Rosamond Crossing Northeast Corner Addition, Block A, Lots 1-15, Conveyance Plat, CVP 24-0004 11. Approve a Resolution regarding the Rosamond Crossing Northeast Corner Addition, Block A, Lots 1-14, Preliminary Plat, PP 24-0012 12. Approve a Resolution regarding the Rosamond Crossing Northeast Corner Addition, Block A, Lots 1-14, Preliminary Site Plan, PSP 24-0005 Items for Individual Consideration 13. Consider/Discuss/Action on a Resolution regarding the Lazy Lane Addition, Block A, Lots 1-3, Final Plat, FP 24-0014 The Public Hearing opened at 6:09 P.M. Planning Manager Lauren Mecke presented the item. Ms. Mecke explained to the Commissioners that the applicant is requesting to subdivide the property into three lots and as part of the request the applicant would require four waivers from the subdivision regulations that would require council approval. Staff recommends approval subject to the waiver from the subdivision regulations. Commissioner Walden asked the length they are trying to get a waiver on. Ms. Mecke stated it was a small portion but was not sure about the length. A motion was made by Commissioner Blanscet, seconded by Chairwoman Walden to recommend approval. Motion Passed. The vote was unanimous. 14. Conduct a Public Hearing/Consider/Discuss/Action on an Ordinance amending the Planned Development Ord No. 792-2018) for Lakeview Estates Phase 3, Block B, Lot 17. PD 24-0003 Planning Manager Ms. Mecke introduced the item and noted that the applicant is requesting to amend the Planned Development to allow for a school. She went on to say that we no longer separate public from private schools. Ms. Mecke described the differences between daycare and school land use, which is based on Human Resources State Law. Staff recommended repealing the original ordinance and replacing it with Planned Development, Local Commercial (C-1) with a specific use of the property as a childcare facility, daycare, and school. There we no Public Comments and staff received no letters of response. Commissioner Hermann asked staff if it were open to C-1 would that mean anything could go there. Ms. Mecke responded that it would be restrictive to just the school, childcare, and daycare use. The applicant Diana Xu addressed the Commissioners about her intent to change the zoning to a private school. Commissioner Martin stated that originally it was stated that the use would be a daycare and private school, and it seems that has changed to just a private school. The applicant replied that she cannot determine an age group because any child would be accepted from 6 weeks and older. The Commissioners asked if she was saying that any age group could attend, and Commissioner Blanscet stated that he disagreed and that children would age out and need to find somewhere else to go so you would not have 14-year-olds and 5-year-olds in the same class. The applicant responded that the children would be divided by age group. There were no speaker cards, and no letters received in response. The Public Hearing closed at 6:21 P.M. A motion was made to repeal and replace the current zoning with a Planned Development/Local Commercial (C-1) by Commissioner Longmire, seconded by Commissioner Martin. The motion passed unanimously. 15. Conduct a Public Hearing/Consider/Discuss/Action on an Ordinance to zone 60± acres on the north side of County Road 371, 1,100± feet west of Bryant Farm Road to Planned Development in accordance with the City Park Heights East, Development Agreement (Res. No. 2024-04-1614) PD 24-0001. The Public Hearing opened at 6:22 P.M. Planning Manager Ms. Mecke Presented the item and stated that it was previously presented back in March and that Council had approved the Pre-Annexation Agreement on April 23rd, she further explained that there have been no changes made. The City Council has determined that the proposed development is appropriate for the area and approved a Pre-Annexation Development Agreement for the project. Staff recommended approval as submitted and no responses were received. Commissioner Longmire asked if this is going to be developed under a PID. Applicant Martin Sanchez addressed the Commissioners and confirmed that the project is part of a PID and added that the land plan stays consistent apart from more street access. Commissioner Longmire mentioned that in the agreement the project would be exempted from competitive bidding and asked why that was. Mr. Sanchez responded that on the private side it would just speed up the process to not use competitive bidding, but he mentioned they would still get a competitive price with competitive bidding. Chairwoman Walden asked the applicant if they have worked with JKB because they will be going under construction as well to change the fire lane. Mr. Sanchez replied that he was aware and that they had been actively coordinating. The Public Hearing closed at 6:30 P.M. A motion to pass was made by Chairwoman Walden and Seconded by Commissioner Martin. The vote was Unanimous. 16. Conduct a Public Hearing/Consider/Discuss/Action on an Ordinance to zone 204± acres at the southwest corner of County Road 285 and County Road 827 to Planned Development in accordance with the City Park Heights West, Development Agreement (Res. No. 2024-04-1615) PD 24-0004. The Public Hearing opened at 6:32 P.M. Planning Manager Lauren Mecke introduced the item, like the last item there is a Pre-Annexation Agreement approved by Council in April. The City Council has determined that the proposed development is appropriate for the area and approved a Pre-Annexation Development Agreement for the project. Staff recommended approval as submitted and no responses were received. The applicant Martin Sanchez stated that much like the other case many aspects are the same and that much of the area is being remapped to see how much of the land is buildable through the CLOMR and LOMR process. Commissioner Longmire asked if the fire station and park proposed were in the flood plain. Mr. Sanchez stated that it is, but they are currently in studies to reclaim as much of the property as possible. Mr. Sanchez said that 90% of the time you can reclaim a lot of it. The Public Hearing closed at 6:41 P.M. A motion to approve was made by Commissioner Longmire and seconded by Commissioner Nylec. Motion Passed unanimously. Adjourn A motion was made by Commissioner Martin, seconded by Commissioner Longmire, to adjourn the meeting. The vote was unanimous. The meeting was adjourned at 6:43 P.M. Chairwoman Jessica Walden ATTEST: Lauren Mecke, Planning Manager Item No. 7. Planning & Zoning Commission Agenda Staff Report Meeting Date:12/2/2024 Staff Contact:Lauren Mecke AGENDA ITEM: Approve a Resolution regarding the AVC Addition, Block A, Lot 1, Preliminary Plat (PP 24-0015) Owner: Walker Morreng LLC/Clinton Walker SUMMARY: A Swim School on 2.5± acres on the west side of County Road 423, 385± feet south of County Road 1036. Located in the ETJ. The purpose of this preliminary plat is to dedicate a fire lane and water line easement on an existing lot. STAFF RECOMMENDATION: Recommended for approval as submitted. ATTACHMENTS: 1.Locator Map - AVC Addition, Block A, Lot 1, Preliminary Plat (PP 24-0015) 2. 3. Resolution - AVC Addition, Block A, Lot 1, Preliminary Plat (PP 24-0015) Exhibit A - AVC Addition, Block A, Lot 1, Preliminary Plat (PP 24-0015) COUNTY ROAD 1036 D R YCRE E K WA S H NOBLEFIRDRROAD RUNNER RD SILVER LEAFLN COUNTY ROAD 423PRIVATEROAD5031 REDFOXRDSPOWELLPKWYEast ForkTr i n it y R i v er121 V a n A l s t y n e 75 SH 121 SH 5 Subject Property City Limits ETJ0 300 600150 Feet November 2024 C:\Users\cbrooks\OneDrive - City of Anna\GIS\Notification Maps\ Notification Maps\AVC Addition, Block A, Lot 1 Preliminary Plat (PP 24-0015) CITY OF ANNA, TEXAS PZ RESOLUTION NO. __2024-_____________ A RESOLUTION OF THE CITY OF ANNA, TEXAS APPROVING AVC ADDITION, BLOCK A, LOT 1, PRELIMINARY PLAT. (PP 24-0015) WHEREAS, In order to provide for the orderly development of land within the Anna city limits and extraterritorial jurisdiction, the City Council of the City of Anna, Texas has adopted Article 9.02 (“Subdivision Regulations”) and Article 9.04 (“Zoning Ordinance”) of the Anna City Code of Ordinances; and WHEREAS, Walker Moreng LLC/Clinton Walker has submitted an application for the approval of AVC Addition, Block A, Lot 1, Preliminary Plat; and WHEREAS, the Preliminary Plat conforms to the City’s Subdivision Regulations; and NOW THEREFORE, BE IT RESOLVED BY THE PLANNING & ZONING COMMISSION OF THE CITY OF ANNA, TEXAS, THAT: Section 1. Recitals Incorporated The recitals above are incorporated herein as if set forth in full for all purposes. Section 2. Approval of Preliminary Plat The Planning & Zoning Commission hereby approves AVC Addition, Block A, Lot 1, Preliminary Plat attached hereto as Exhibit A. PASSED AND APPROVED by the Planning & Zoning Commission of the City of Anna, Texas, on this 2nd day of December, 2024. ATTEST: APPROVED: Director of Development Services, Planning & Zoning Commission, Chair Stephanie Scott-Sims, AICP Jessica Walden COUNTY ROAD 423S 00° 49' 19" W30. Item No. 8. Planning & Zoning Commission Agenda Staff Report Meeting Date:12/2/2024 Staff Contact:Lauren Mecke AGENDA ITEM: Approve a Resolution regarding the Freestone Anna Phase 2, Preliminary Plat. (PP 24- 0014) Owner: 615 Foster Crossing Investment LLC SUMMARY: 288 Multifamily units on three lots on 14.51± acres on the north side of E. Foster Crossing Road, 925± feet west of County Road 422. Located in the ETJ. The purpose of this preliminary plat is to dedicate fire lane and water line easements. STAFF RECOMMENRDATION: Recommended for approval as submitted. ATTACHMENTS: 1.Locator Map - Freestone Anna Phase 2, Preliminary Plat. (PP 24-0014) 2. 3. Resolution - Freestone Anna Phase 2, Preliminary Plat. (PP 24-0014) Exhibit A - Freestone Anna Phase 2, Preliminary Plat. (PP 24-0014) S POWELL PKWYLEONARDAVEROCKET BEND DRW A R N ER D R BROCK DRMASTONDRHAVEN DR PENN ST LILLY LNRILEYDRCAINDRINDIANOLA TRL GOULD WAY G A RDENDALEHOLLOW LNE FOSTER CROSSING RDTHAYNEDR SUNBEAM CVWILSONDR CROSSEDRHILLRICHDRBURGERTDRBURLINGTONCRESTTRLTATE LNSTAFFORDSPOINTLNVAILLNHUNTINGTON DRASKEWDREFINLEYBLVD B R OOK DR COUNTY ROAD 422East ForkTr i n it y R i v er121 V a n A l s t y n e 75 SH 121 SH 5 SubjectProperty City Limits ETJ 0 500 1,000250 Feet November 2024 C:\Users\cbrooks\OneDrive - City of Anna\GIS\Notification Maps\Notification Maps\Freestone Anna Phase 2 CITY OF ANNA, TEXAS PZ RESOLUTION NO. __2024-_____________ A RESOLUTION OF THE CITY OF ANNA, TEXAS APPROVING FREESTONE ANNA, PHASE 2, PRELIMINARY PLAT. (PP 24-0014) WHEREAS, In order to provide for the orderly development of land within the Anna city limits and extraterritorial jurisdiction, the City Council of the City of Anna, Texas has adopted Article 9.02 (“Subdivision Regulations”) and Article 9.04 (“Zoning Ordinance”) of the Anna City Code of Ordinances; and WHEREAS, 615 Foster Crossing Investment LLC has submitted an application for the approval of Freestone Anna, Phase 2, Preliminary Plat; and WHEREAS, the Preliminary Plat conforms to the City’s Subdivision Regulations; and NOW THEREFORE, BE IT RESOLVED BY THE PLANNING & ZONING COMMISSION OF THE CITY OF ANNA, TEXAS, THAT: Section 1. Recitals Incorporated The recitals above are incorporated herein as if set forth in full for all purposes. Section 2. Approval of Preliminary Plat The Planning & Zoning Commission hereby approves Freestone Anna, Phase 2, Preliminary Plat attached hereto as Exhibit A subject to additions and/or alterations to the engineering plans as required by the City Engineer. PASSED AND APPROVED by the Planning & Zoning Commission of the City of Anna, Texas, on this 2nd day of December, 2024. ATTEST: APPROVED: Director of Development Services, Planning & Zoning Commission, Chair Stephanie Scott-Sims, AICP Jessica Walden CITY OF ANNA CITY OF ANNA E.T.J. L49L47CALLED 16.426 ACRES CANVAS ANNA OWNER, LLC INST. NO. 2022000069950 O.P.R.C.C.T. CALLED 360.545 ACRES HARLAN PROPERTIES, INC. INST. NO. 20121128001650300 O.P.R.C.C.T. REMAINDER OF CALLED 20.140 ACRES 615 FOSTER CROSSING INVESTMENT LLC INST. NO. 2022000125113 O.P.R.C.C.T. 1/2" IRFC "ILLEGIBLE" BEARS N 02°32' E 2.86') IRSC IRSC MAG NAIL SET 1/2" IRF EXISTING 15' WATER LINE EASEMENT VOL. 1056, PG. 877, L.R.C.C.T. INST. NO. 2015123001631150 O.P.R.C.C.T. EXISTING 40' EASEMENT TO COLLIN COUNTY INST. NO. 2022000156924 O.P.R.C.C.T. EXISTING 25' WATER & SANITARY SEWER ESMT. INST. NO. 2023000018404 O.P.R.C.C.T. EXISTING TEMP. DRAINAGE ESMT. INST. NO. 2023000019970 O.P.R.C.C.T.DAVI D E. W. B A B B S U R V E Y ABS T. N O. 3 3 70' TEMPORARY CONSTRUCTION EASEMENT INST. NO. 2023000097787 O.P.R.C.C.T. E. FOSTER CROSSING ROAD (COUNTY ROAD 421) APPARENT VARIABLE WIDTH R.O.W. - NO RECORD FOUND) 40' RIGHT OF WAY DEDICATION 0.368 ACRE 16,051 SQ. FT.) LOT 1, BLOCK A CANVAS AT ANNA VOL. 2023, PG. 976 P.R.C.C.T. DRAINAGE & DETENTION EASEMENT VOL. 2023, PG. 976 P.R.C.C.T. 24' FIRE LANE, ACCESS, UTILITY & DRAINAGE ESMT. VOL.2023, PG. 976 P.R.C.C.T. 24' FIRE LANE, ACCESS, UTILITY & DRAINAGE ESMT.VOL.2023, PG. 976P.R.C.C. T.40' RIGHT OF WAY DEDICATION VOL.2023, PG. 976 P.R.C.C. T.7.5' UTILITY ESMT.VOL. 782, PG. 599O.P.R.C.C.T. 7.5' UTILITY ESMT. VOL. 782, PG. 599O.P. R.C. C.T. 7.5' UTILITY ESMT.VOL. 782, PG. 599 O.P.R.C.C. T.7. 5' UTILITY ESMT.VOL. 782, PG. 599 O. P.R.C.C. T.WATER EASEMENT VOL. ____, PG. ____P.R. C.C.T. DRAINAGE AND DETENTION EASEMENT VOL. ____, PG. ____P. R.C.C. T.26' F.A.U.D.E. VOL. ____, PG. ____P. R.C. C.T.26' F.A. U.D.E. VOL. ____, PG. ____ P.R.C.C.T. PROSE TOWN SQUARE LOT 1, BLOCK A VOL. ____, PG. ____P. R.C.C. T.10' W.E.VOL. ____, PG. ____P. R.C.C. T.10' W.E.VOL. ____, PG. ____P. R.C.C. T.15' W.E.VOL. ____, PG. ____P. R.C.C.T.15' W. E.VOL. ____, PG. ____P.R.C.C. T.10' W.E.VOL. ____, PG. ____ P.R.C. C.T.10' W. E.VOL. ____, PG. ____ P.R.C.C. T.10' W.E.VOL. ____, PG. ____P.R. C.C.T.10' W.E. VOL. ____, PG. ____P.R.C.C. T.26' F.A. U.D. E. VOL. ____, PG. ____ P. R. C. C. T. CITY OF ANNA E. T.J. CITY OF ANNA LOT 1, BLOCK A 14.138 ACRES 615,838 SQ. FT.W.E.26' F.A.U.D. E. 26' F. A. U. D.E.26' F.A.U. D. E. 26' F.A.U. D. E. 26' F.A.U.D.E.26' F. A. U. D. E. S. S. E.S0° 21'28" W800.79' N89°01'41" W 401.12' N0°06' 20" W206. 90'S89° 53' 40" W 87. 25' N0° 06' 20" W1110. 83'125.63' 29.64' N0°00'01"W176. 92'L1 L2 C1N45° 00'01"W77.89' C2N0°00'01"W220.10' C3L3C4N0°00' 01"W84. 05'C5L4 C6 520. 13'114.32'30.95' L5 C7104. 34' 180. 03'C13L10C1 4 L11 L12 C15S5°31'40"E99.82'S0°00'01"E253.39'S9°59' 59"W107.23'S0° 00' 01"E148.75'L13N0° 00'01"W105. 54'C1 7 28.47'S89° 59' 59"W 221.46'C18 S0°00'01" E116.26'S89° 01'41"E 401.44'40. 00'40.01' L14L15N89°59'59" E 209.49' C19S45°00'01"E1 3 2 8 2 C20S0°00'01"E220.10'43.07'162.30'C21L16 C22L17C23S89° 59'59"W 275.61'C 2 4 C16 C2588. 08'N5°31' 40" W97.08' N0°00'01"W251. 11'N9°59'59" E85.06'C26L18L19C 2 7 C31 N10°37'10" E59.76' C32N89°59'59"E 277. 41'L21 L22L23 L24 L25L26 L36 L37 L38 660.42' 349.38'26. 06'W. E.10' W.E.S. S.E.15. 93'L42 L43 17.61'L44L45 L46 L 4 8 5 8 9 1 10' W.E.W.E.LOT 1, BLOCK 1 ANNA ELEMENTARY NO. 3 VOL. 2018, PG. 253 P. R.C.C.T. ANNA CROSSING PHASE 1B VOL. 2017, PG. 570 P.R.C.C.T.43 44 4546 515253545556 BLOCK A47484950 BROCK DRIVE50' R. O.W. - VOL. 2017, PG. 570, P.R.C.C.T.) 1/2" IRF (RM) IRSC 3/ 8" IRF (RM)1/2" IRFC CORWING ENG INC." 1/ 2" IRFC CORWING ENG INC."1/ 2" IRFC CORWING ENG INC."1/ 2" IRFC CORWING ENG INC." 1/ 2" IRFC CORWING ENG INC." 1/ 2" IRFC CORWING ENG INC." GRA N D E R S O N S T A R K S U R V E Y ABS T. N O. 7 9 8 P.O. B.1/2" IRFC CORWING ENG INC."7. 5' UTILITY ESMT.VOL. 782, PG. 599 O. P.R.C.C. T.7.5' UTILITY ESMT.VOL. 782, PG. 599O.P.R.C. C.T.7.5' UTILITY ESMT.VOL. 782, PG. 599O.P.R. C.C.T.10' W.E.VOL. ____, PG. ____ P.R.C.C. T. 10' W. E.VOL. ____, PG. ____P. R.C. C.T. 10' W. E.VOL. ____, PG. ____P. R.C. C.T. 15' W. E.VOL. ____, PG. ____P. R.C. C.T. 26' F. A.U. D.E. VOL. ____, PG. ____ P.R. C. C. T. 26' F. A. U. D. E. VOL. ____, PG. ____ P. R. C. C. T. CITY OF ANNA E. T. J.CITY OF ANNAW. E.W.E.26' F.A.U.D. E.26' F.A. U.D.E.26' F.A.U.D. E.20' S.S. E.REMAINDER OF CALLED 20.140 ACRES 615 FOSTER CROSSING INVESTMENT LLC INST. NO. 2022000125113 O. P.R.C.C. T.S0°11'14" W517.65'S89°18' 53"E 497.47' 401.44'N6°30' 48"W206.03'N0° 00'01"W138.08' C9L6136.65'L7 C10 C11 210.78' 50.81' N89°59' 59"E 352.56' C12S0°00' 01"E324. 49'200. 15'393. 99'L8 L9251.72' 9.97' C8 C28 S0°00' 01"E125. 92'C29S89° 59'59" W 317. 80'C30S0° 00'01" E324. 49' 188. 78' 120. 00' L20L27 L28L29 L30 L31L32 L33 L34 L35 N6° 30' 48" W258. 99' 10' W.E. 70.97'10' S.S.E. L39L40 L41 LINE TABLE NO.L1 L2 L3 L4 L5 L6 L7 L8 L9 L10 L11 L12 L13 L14 L15 L16 L17 L18 L19 BEARING N67°29' 59"E N67° 29'59"E N32°58'30" E S89°53' 39" W N89° 53'39" E S89° 53'39" W N89° 53'39" E S89° 59'59" W S89° 59'59" W S10° 37'10" W N89° 59'59" E S89° 59'59" W S89°59' 59"W N32°31' 57"E N10°03' 12"E S32°58' 30"W S00°00' 01"E N07°34' 19"W N03°39' 34"W LENGTH 28. 43'28. 47'37. 83'38.66'36. 19'12.98'12. 98'38.02'37. 96'37.32'20. 32'21.96'26. 00'30.84'26. 41'37.83'40. 04'26.23'26. 05'LINE TABLE NO. L20 L21 L22 L23 L24 L25 L26 L27 L28 L29 L30 L31 L32 L33 L34 L35 L36 L37 L38 BEARING N00°00'01"W S89°59'59"W S00° 00'01" E N89° 59'59" E N84° 28'20" E N05° 31'40" W S90° 00'00" W N84° 01'54" E N06° 30'48" W N90° 00'00" W S90° 00'00" W S00° 00' 01" E N90° 00' 00" E N00° 00' 01" W N89° 59' 59" E S00° 00'01"E N00°00'00" E N90°00' 00"W S00° 00'00"E LENGTH 26.00' 16.93'14. 73'16.93' 10.34'18. 16'9.52' 15.63'18. 51'14.44' 10.34'15. 71'10.34' 14.18'10. 00'14.18' 12. 45'10. 00'10. 16'CURVE TABLE NO. C1 C2 C3 C4 C5 C6 C7 C8 C9 C10 C11 C12 C13 C14 C15 C16 DELTA 45° 00'00" 45°00' 00"32° 58' 31"32° 58'31" 90°06' 20"12° 14'20" 96°24' 27"6° 30'47" 90°06' 20"32° 57'58" 32°51' 38"90° 00'00" 10°37' 11"100° 37'11" 95°31'39"5° 31'39"RADIUS 25. 00'51.00'51. 00'25.00'25. 00'30.00'25. 00'51.00'25. 00'51.00'25. 00'51.00'51. 00'25.00'25. 00'51.00'LENGTH 19.63'40.06' 29.35'14.39' 39.32'6.41' 42.07'5.80' 39.32'29.34' 14.34'80.11' 9. 45'43. 90'41. 68'4. 92'CHORD BEARING N22° 30'01" W S22° 30'01" E S16° 29'15" W N16° 29'15" E N45° 03'11" W S84° 28'37" W N41° 41' 26" E S03° 15' 24" E N45° 03' 11" W N73° 37' 22"W S73°34' 12"E N45°00' 01"W N05°18' 35"E S39°41' 25"E S42°14' 10"W N02°45' 50"W CHORD 19. 13'39.03'28. 95'14.19'35. 39'6.40'37. 28'5.79'35. 39' 28.94' 14.14' 72.12' 9.44' 38.48' 37.02' 4.92' CURVE TABLE NO.C17 C18 C19 C20 C21 C22 C23 C24 C25 C26 C27 C28 C29 C30 C31 C32 DELTA 90° 00'00" 90°00'00"45°00'00"45°00'00"32°58'31"32°58'31" 90°00'00"84°28'21"5°31'39"80°00'00"83°29' 13"6°30'47"90°00'00"90°00'00"10°37'11"79°22'49" RADIUS 25.00'25.00'25.00'25.00'25.00'51.00'25.00'25.00'25.00'25. 00'25.00'25.00'25.00'25.00'25.00'25.00'LENGTH 39.27'39.27' 19.63'19.63'14.39'29.35'39.27'36.86'2.41'34.91'36.43'2. 84'39.27'39.27'4.63'34.64'CHORD BEARING N45° 00'01"W S44°59'59"W S67°30'01"E S22°30'01"E S16°29'15"W N16°29'15"E S44°59'59"W N47°45'50"W N02°45'50"W N49°59'59"E S48°15'24"E S03°15'24"E S44°59' 59"W N45°00'01"W N05°18'35"E N50°18'35"E CHORD 35.36'35. 36'19.13' 19.13' 14.19'28. 95'35.36' 33.61' 2.41' 32. 14' 33. 29' 2.84'35.36'35.36'4.63' 31.93'LINE TABLE NO. L39 L40 L41 L42 L43 L44 L45 L46 L47 L48 L49 BEARING N00° 00'01"W N89°59'59"E S00°00'01"E N83° 29'12"E S06°30'48"E S00°00'00" E N90°00'00"E N00° 00'00"ES44°59' 59" W S45°00'01"E N46° 28' 03" E LENGTH 8.98'10.00' 8.98' 14.55'9. 50'4.41' 10.00' 9.44'11.90'14.49'11. 90'DWG NAME: K:\FRI_SURVEY\060021400-FREESTONE SQUARE - ANNA\DWG\060021400 FREESTONE TOWN SQUARE PH2 PP.DWGPLOTTED BYSKEETERS, CODY 11/25/2024 2:10 PM LAST SAVED11/25/2024 1:55 PM Copyright © 2024 Kimley-Horn and Associates, Inc. All rights reservedGRAPHIC SCALE IN FEET 060 30 60 120 1" = 60' @ 24X36 NORTH FLOOD STATEMENT:According to Federal Emergency Management Agency's Flood Insurance Rate Map No. 48085C060J, for Collin County, Texas and incorporated areas, dated June 2, 2009, this property is located within Zone X (unshaded) defined as "Areas determined to be outside the 0. 2% annual chance floodplain"If this site is not within an identified special flood hazard area, this flood statement does not imply that the property and/or the structures thereon will be free from flooding or flood damage. On rare occasions, DWG NAME: K:\ FRI_SURVEY\ 060021400-FREESTONE SQUARE - ANNA\DWG\060021400 FREESTONE TOWN SQUARE PH2 PP.DWG PLOTTED BYSKEETERS, CODY 11/25/2024 2:10 PM LAST SAVED11/25/20241: 55 PM Copyright © 2024 Kimley-Horn and Associates, Inc. All rights reservedScale Drawn by CDSN/A Checked by Date Project No.Sheet No.Frisco, Texas 75034 6160 Warren Parkway, Suite 210 Tel. No. (972) 335- 3580 Fax No. (972) 335- 3779FIRM # 10193822 KHA 10/10/2024 063260500 1 OF 2 APPLICANT:Kimley-Horn and Associates, Inc. 13455 Noel Road, Suite 700 Dallas, TX 75240 Ph: 972.770.1300 Fax: 972.239.3820 Contact: Rachel Revilla, PE OWNER:615 Foster Crossing Investment, LLC 777 Post Oak Blvd. Suite 255 Houston, TX 77056 Ph: 214-263-2088 Contact: Britton Church PRELIMINARY PLAT FREESTONE ANNA PHASE 2 BEING 14.506 ACRES SITUATED IN THE GRANDERSON STARK SURVEY, ABSTRACT NO. 798,COLLIN COUNTY, TEXAS OCTOBER 2024 PP 24-0013 STATE OF TEXAS §COUNTY OF COLLIN §KNOW ALL MEN BY THESE PRESENTS That I, Michael B. Marx, do hereby certify that I prepared this plat and the field notes made a part thereof from an actual and accurate survey of the land and that the corner monuments shown thereon were properly placed under my supervision.Michael B. Marx Registered Professional Land Surveyor Texas Registration No. 5181 Kimley-Horn and Associates, Inc.6160 Warren Pkwy., Suite 210 Frisco, TX 75034 972) 335-3580 michael.marx@kimley-horn.com STATE OF TEXAS §COUNTY OF COLLIN §Before me, the undersigned authority, a Notary Public in and for said County and State, on this day personally appeared Michael B. Marx, known to me to be the person whose name is subscribed to the foregoing instrument and acknowledged to me that he/she executed the same for the purpose and considerations therein expressed. Given under my hand and seal of office, this _______________ day of ________________________________,2024. Notary Public in and for the State of Texas Printed Name My Commission Expires PRELIMINARY THIS DOCUMENT SHALL NOT BE RECORDED FOR ANY PURPOSE AND SHALL NOT BE USED OR VIEWED OR RELIED UPON AS A FINAL SURVEY DOCUMENT OWNER'S CERTIFICATION NOW, THEREFORE, KNOW ALL MEN BY THESE PRESENTS:THAT 615 FOSTER CROSSING INVESTMENT LLC; acting herein by and through their duly authorized officers, do hereby adopt this plat designating the hereinabove described property as FREESTONE TOWN SQUARE PHASE 2, an addition to the Collin County, Texas, and does hereby dedicate, in fee simple, to the public use forever, the streets and alleys shown thereon.The streets and alleys are dedicated for street purposes. The easements and public use areas, as shown, are dedicated for the public use forever, for the purposes indicated on this plat. In addition, utility easements may also be used for the mutual use and accommodation of all public utilities desiring to use or using the same unless the easement limits the use to particular utilities,said use by public utilities being subordinate to the public's and City of Anna's use thereof. The City of Anna and public utility entities shall have the right to remove and keep removed all or parts of any buildings, fences, trees, shrubs, or other improvements or growths which may in any way endanger or interfere with the construction, maintenance, or efficiency of their respective systems in said easements. The City of Anna and public utility entities shall at all times have the full right of ingress and egress to or from their respective easements for the purpose of constructing, reconstructing, inspecting, patrolling,maintaining, reading meters, and adding to or removing all or parts of their respective systems without the necessity at any time of procuring permission from anyone.That the undersigned does hereby covenant and agree that he (they) shall construct upon the fire lane easements, as dedicated and shown hereon, a hard surface and that they shall maintain the same in a state of good repair at all times and keep the same free and clear of any structures, fences, trees, shrubs, or other improvements or obstruction, including but not limited to the parking of motor vehicles, trailers, boats, or other impediments to the access of fire apparatus. The maintenance of paving on the fire lane easements is the responsibility of the owner, and the owner shall post and maintain appropriate signs in conspicuous places along such fire lanes, stating "Fire Lane, No Parking." The police or his duly authorized representative is hereby authorized to cause such fire lanes and utility easements to be maintained free and unobstructed at all times for Fire Department and emergency use. The undersigned does covenant and agree that the access easement may be utilized by any person or the general public for ingress and egress to other real property, and for the purpose of General Public vehicular and pedestrian use and access, and for Fire Department and emergency use, in, along, upon, and across said premises, with the right and privilege at all times of the City of Anna, its agents, employees, workmen, and representatives having ingress, egress,and regress in, along, upon, and across said premises.DRAINAGE AND DETENTION EASEMENT STATE OF TEXAS COUNTY OF COLLIN CITY OF ANNA This plat is hereby adopted by the Owners and approved by the City of Anna (called “City”) subject to the following conditions which shall be binding upon the Owners, their heirs, grantees and successors:The portion of Block A, as shown on the plat is called “Drainage and Detention Easement.” The Drainage and Detention Easement within the limits of this addition, will remain open at all times and will be maintained in a safe and sanitary condition by the owners of the lot or lots that are traversed by or adjacent to the Drainage and Detention Easement. The City will not be responsible for the maintenance and operation of said Easement or for any damage to private property or person that results from conditions in the Easement, or for the control of erosion. No obstruction to the natural flow of storm water run- off shall be permitted by construction of any type of building, fence, or any other structure within the Drainage and Detention Easement as hereinabove defined, unless approved by the City Engineer. Provided, however, it is understood that in the event it becomes necessary for the City to erect or consider erecting any type of drainage structure in order to improve the storm drainage that may be occasioned by the City shall have the right to enter upon the Drainage and Detention Easement at any point, or points,to investigate, survey or to erect, construct and maintain any drainage facility deemed necessary for drainage purposes. Each property owner shall keep the Drainage and Detention Easement clean and free of debris, silt, and any substance which would result in unsanitary conditions or obstruct the flow of water, and the City shall have the right of ingress and egress for the purpose of inspection and supervision of maintenance work by the property owner to alleviate any undesirable conditions which may occur. The natural drainage through the Drainage and Detention Easement is subject to storm water overflow and natural bank erosion to an extent which cannot be definitely defined. The City shall not be held liable for any damages of any nature resulting from the occurrence of these natural phenomena, or resulting from the failure of any structure, or structures, within the Easement.This approved subject to all platting ordinances, rules, and regulations of the City of Anna, Texas.WITNESS, my hand at ____________, ___________________, this the _______ day of ___________, 2024.615 FOSTER CROSSING INVESTMENT LLC, a Texas limited partnership By: 615 FOSTER CROSSING INVESTMENT LLC, a Texas limited liability company,Its General Partner By: _____________________________________________Printed Name) Title)STATE OF TEXAS §COUNTY OF ________________§Before me, the undersigned authority, a Notary Public in and for said County and State, on this day personally appeared known to me to be the person whose name is subscribed to the foregoing instrument and acknowledged to me that he/she executed the same for the purpose and considerations therein expressed.Given under my hand and seal of office, this _______________ day of ________________________________, 2024.Notary Public in and for the State of Texas Printed Name My Commission Expires CERTIFICATE OF APPROVAL APPROVED on this the ________day of ____________, 20____, by the Planning & Zoning Commission, City of Anna, Texas.Planning & Zoning Commission Chair Director of Development Services OWNER'S CERTIFICATE STATE OF TEXAS §COUNTY OF COLLIN §WHEREAS 615 FOSTER CROSSING INVESTMENT LLC is the sole owners of the following described tract of land:BEING a tract of land situated in the Granderson Stark Survey, Abstract No. 798, in the City of Anna E.T.J., Collin County, Texas and being all a portion of a called 20.140-acre tract of land, described Special Warranty Deed to 615 Foster Crossing Investment, LLC, as recorded in Instrument No. 2022000125113, of the Official Public Records of Collin County, Texas, and being more particularly described by metes and bound as follows:BEGINNING a 1/2-inch iron rod found for the northeast corner of a said 20.140-acre tract of land, common to the southeast corner of Anna Crossing Phase 1B, an addition to the City of Anna according to the plat recorded in Volume 2017, Page 570 of the Plat Records of Collin County, Texas, same being on the west line of Lot 1, Block 1 of Anna Elementary No. 3, an addition to the City of Anna according to the plat recorded in Volume 2018, Page. 253, of the Plat Records of Collin County, Texas;THENCE South 00°11'14" West, along the easterly line of said 20.140- acre tract and the westerly line of said Lot 1, Block 1, a distance of 517.65 feet to 1/2 inch iron rod found for the southwest corner of said Lot 1, Block 1, common to the northwest corner of a called 16.426-acre tract of land, described in a deed to Canvas Anna Owner, LLC, recorded in Instrument No. 2022000069950, of the Official Public Records of Collin County, Texas, same being the northwest corner of Lot 1, Block A of Canvas at Anna, an addition to Collin County, as recorded in Volume 2023, Page 976 of the Plat Records of Collin County, Texas;THENCE South 00°21'28" West, continuing along said easterly line, and along the westerly line of said 16.426-acre tract and said Lot 1, Block A, a distance of 800.79 feet to a point the southeast corner of said 20.140-acre tract, common to the southwest corner of said 16.426-acre tract, same being in the north line of a called 360.545-acre tract of land described in a Special Warranty Deed with Vendor's Lien to Harlan Properties, Inc., recorded in Instrument No. 20121128001650300 of said Official Public Records, and in the approximate centerline of said East Foster Crossing Road (County Road 421), from which a 1/2 inch iron rod with plastic cap ILLEGIBLE), bears North 02°32' East, 2.86 feet;THENCE North 89°01'41" West, along the south line of said 20.140-acre tract, the north line of said 360.545-acre tract, and with the approximate centerline of said East Foster Crossing Road (County Road 421), and a distance of 401.12 feet to a mag nail set for the southeast corner of a called 15.626-acre tract of land, described Special Warranty Deed to Prose Town Square Venture, LP, as recorded in Instrument No. 2023000097785, of the Official Public Records of Collin County, Texas;THENCE departing the north line of said 360.545-acre tract, and the approximate centerline of said East Foster Crossing Road County Road 421), and along the easterly line of said 15.626-acre tract, the following:North 00°06'20" West, a distance of 206.90 feet to a 5/8-inch iron rod with red plastic cap stamped “KHA” set for corner;South 89°53'40" West, a distance of 87.25 feet to a 5/ 8-inch iron rod with red plastic cap stamped “KHA” set for corner;North 00°06'20" West, a distance of 1,110.83 feet to a 5/8-inch iron rod with red plastic cap stamped “KHA” set for the northeast corner of said 15. 626-acre tract, same being on the south line of said Anna Crossing Phase 1B;THENCE South 89°18'53" East, along the north Item No. 9. Planning & Zoning Commission Agenda Staff Report Meeting Date:12/2/2024 Staff Contact:Lauren Mecke AGENDA ITEM: Approve a Resolution regarding the G2 Motorsports, Minor Plat. (MP 24-0003) Owner: Lou Gigliotti SUMMARY: A race track on one lot on 182.56± acres on the northeast corner of Farm Road 2862 and County Road 526. Located in the ETJ. The development was previously approved by a development plat. The purpose of the minor plat is to combine eight lots into one lot. STAFF RECOMMENDATION: Recommended for approval as submitted. ATTACHMENTS: 1.Locator Map - G2 Motorsports, Minor Plat. (MP 24-0003) 2. 3. Resolution - G2 Motorsports, Minor Plat. (MP 24-0003) Exhibit A - G2 Motorsports, Minor Plat. (MP 24-0003) COUNTYROAD577S GEORGIAAVEWHITEOAKCIRF ARWAYALMA AVEFM 3133COUNTY ROAD 527 EHOUSTON STNCHURCHST STERLING DR WHOUSTON ST W PUBLIC RD W AUSTIN ST S CHURCH ST W BAILEY ST PRIVATEROAD5692COUNTYROAD581WELLSTCOUNTYROAD584BROADWAYAVEPECAN HOLLOW CIR SBOWDENAVEN BOWDENAVESUNSETDRE BAILEY ST E PUBLIC RD E AUSTIN ST FM2862W ESTMORELANDCIRCOUNTY ROAD529COUNTY ROAD 528OAKCREE K DR GRA Y BILLRDI NGR A M DR PRIV ATEROA D5603COUNTYROAD525SHALOM L NN STATE HIGHWAY 121 ADVENTURE CAMP EAST COUNTY ROAD 526 East ForkTr i n it y R i v er121 V a n A l s t y n e 75 SH 121 SH 5 Subject Property CityLimits ETJ 0 1, 000 2,000500 Feet November 2024 C:\Users\cbrooks\OneDrive - City of Anna\GIS\ Notification Maps\Notification Maps\G2 Motorsports Minor CITY OF ANNA, TEXAS PZ RESOLUTION NO. __2024-_____________ A RESOLUTION OF THE CITY OF ANNA, TEXAS APPROVING G2 MOTORSPORTS, MINOR PLAT (MP 24-0003) WHEREAS, In order to provide for the orderly development of land within the Anna city limits and extraterritorial jurisdiction, the City Council of the City of Anna, Texas has adopted Article 9.02 (“Subdivision Regulations”) and Article 9.04 (“Zoning Ordinance”) of the Anna City Code of Ordinances; and WHEREAS, Lou Gigliotti has submitted an application for the approval of G2 Motorsports, Minor Plat; and WHEREAS, the Minor Plat conforms to the City’s Subdivision Regulations; and NOW THEREFORE, BE IT RESOLVED BY THE PLANNING & ZONING COMMISSION OF THE CITY OF ANNA, TEXAS, THAT: Section 1. Recitals Incorporated The recitals above are incorporated herein as if set forth in full for all purposes. Section 2. Approval of Minor Plat The Planning & Zoning Commission hereby approves G2 Motorsports, Minor Plat attached hereto as Exhibit A. PASSED AND APPROVED by the Planning & Zoning Commission of the City of Anna, Texas, on this 2nd day of December, 2024. ATTEST: APPROVED: Director of Development Services, Planning & Zoning Commission, Chair Stephanie Scott-Sims, AICP Jessica Walden TRACT 1" CALLED75.957 ACRE TRACTG2 MOTORSPORTS PARK, LLCINST. NO. 20211202002448390O.P. R.C. C.T." FIRSTTRACT"CALLED120 ACRESVICTOR A. WOODLING, JR.( LESS 5.373 ACRES OF LAND TO THE STATE OF TEXAS)INST. NO. 20100108000023560O.P.R.C.C.T."TRACT 3"CALLED 11.48 ACRE TRACTG2 MOTORSPORTS PARK, LLCINST. NO. 20211202002448390O.P. R. C. C. T." TRACT 4" CALLED 12.00 ACRESG2 MOTORSPORTS PARK, LLCINST. NO. Copyright © 2024 Kimley-Horn and Associates, Inc. All rights reserved DWG NAME: K:\ DAL_SURVEY\ 064580700-G2 MOTORSPORTS\DWG\064580700-G2 MOTORSPORTS_ FP.DWG PLOTTED BYMENDOZA, CANDE 11/ 22/2024 1:36 PM LAST SAVED11/22/2024 12:40 PMScale Drawn by N/AChecked by Date Project No.Sheet No.Tower, Suite 700, Dallas, Texas 75240 13455 Noel Road, Two Galleria Office Tel. No. (972) 770-1300 Fax No. (972) 239-3820FIRM # 10115500 AEL/ CM DJD NOV. 2024 064580700 2 OF 2 OWNERS CERTIFICATE STATE OF TEXAS §COUNTY OF COLLIN §WHEREAS, G2 MOTORSPORTS, LLC; GARAGES OF G2, LLC; LOUIS (LOU) GIGLIOTTI; and KAREN GIGLIOTTI, are the sole owners of a tract of land situated in the John Chalmers Survey, Abstract No. 233, City of Anna ETJ, Collin County, Texas, and being all of a called 75.957 acre tract of land designated as “Tract 1”, a called 70.689 acre tract of land designated as “Tract 2”, a called 11.48 acre tract of land designated as “Tract 3”,and a called 12.00 acre tract of land designated as “Tract 4” as described in the Warranty Deed with Vendor's Lien to G2 Motorsports Park, LLC, recorded in Instrument No. 20211202002448390, Official Public Records,Collin County, Texas, said 4 tracts being subsequently described as a combined 169.585 acre tract of land in the Deed of Trust Security Agreement, Financing Statement and Assignments of Rents to G2 Motorsports Park LLC,recorded in Instrument No. 202400054424, Official Public Records, Collin County, Texas; and being all of a called 10.37 acre tract of land described in the General Warranty Deed to Garages of G2, LLC, recorded in Instrument No. 2023000139372, Official Public Records, Collin County, Texas; all of a called 1.000 acre tract of land described in the General Warranty Deed to Lou Gigliotti, recorded in Instrument No. 2024000032025,Official Public Records, Colin County, Texas; all of a called 1.00 acre tract of land described in the General Warranty Deed with Vendor's Lien to Karen Gigliotti and Louis Gigliotti, recorded in Instrument No.20180824001066150, Official Public Records, Collin County, Texas; and all of a called 0.591 acre tract of land described in the General Warranty Deed to Lou Gigliotti, recorded in Instrument No. 20200415000536740,Official Public Records, Collin County, Texas, and being more particularly described as follows:BEGINNING at a cut “X” in concrete found for corner in the northeast right-of-way line of Farm-to-Market Road No. 2862 (a variable width public right-of-way), and being the west corner of a LG MOTORSPORTS PARK ADDITION, LOTS 1 & 2, an addition to the ETJ of the City of Anna, according to the plat thereof recorded in Instrument No. 20190109010000110, Official Public Records, Collin County, Texas, and being in the southwest line of said “Tract 2”;THENCE with the said northeast right-of-way line, the following courses and distances:North 45°49'00" West, a distance of 77.55 feet to a 1/2-inch iron rod with plastic cap stamped “RPLS 4613”found for corner;North 51°10'00" West, a distance of 210.50 feet to a 1/2-inch iron rod with plastic cap stamped “ RPLS 4613” found for corner;North 07°40'00" West, a distance of 38.00 feet to a 5/8-inch iron rod with red plastic cap stamped "KHA"set for corner;North 61°10'00" West, a distance of 16.50 feet to a 1/2-inch iron rod with plastic cap stamped “RPLS 4613” found for the west corner of said "Tract 2", and being in the south right-of-way line of Broadway Avenue (a called 50-foot wide right-of-way);THENCE with said south right-of-way line, North 88°55'45" East, a distance of 61.46 feet to a 5/8-inch iron rod with red plastic cap stamped "KHA" set for the southwest corner of said 0.591 acre tract of land and being in the west right-of-way line of said Broadway Avenue;THENCE with said west right-of-way line, North 00°19'22” East, a distance of 100.81 feet to a 1-inch iron rod found for the northwest corner of said 0.591 acre tract, same being the southwest corner of Lot 6 of CUNNINGHAM ADDITION, an addition to Collin County, Texas, according to the plat thereof recorded in Instrument No. 20061012010004450, Official Public Records, Collin County, Texas;THENCE with the north line of said 0.591 acre tract and the south line of said Lot 6, North 89°01'21” East, a distance of 257.06 feet to a 5/ 8-inch iron rod with red plastic cap stamped "KHA" set for the northeast corner of said 0.591 acre tract and the southwest corner of said Lot 6;THENCE with the west line of said CUNNINGHAM ADDITION, North 00°09'27" West, a distance of 1,063.61 feet to a 5/8-inch iron rod with red plastic cap stamped "KHA" set for the northwest corner of said 10.37 acre tract,and being in the approximate centerline of Graybill Road, (an apparent prescriptive right-of-way at this point);THENCE with the approximate centerline of said Graybill Road, the following courses and distances:South 89°18'15" East, a distance of 463. 65 feet to a MAG nail with washer stamped "KHA" set for the northeast corner of said 10.37 acre tract and the northwest corner of said “Tract 4”;South 89°22'52" East, a distance of 728.61 feet to a MAG nail found for the most northerly northeast corner of said “Tract 3”, and being the northwest corner of said 1.000 acre tract Lou Gigliotti tract;South 89°41'08'' East, passing at a distance of 260.12 feet, a MAG nail found for the northeast corner of said 1.000 acre Lou Gigliotti tract, same being the northwest corner of said 1.00 Karen Gigliotti and Louis Gigliotti tract, continuing in all a total distance of 520.13 feet to a MAG nail with washer stamped "RPLS 4613" found for the northeast corner of said Karen Gigliotti and Louis Gigliotti tract, and being the most northerly northwest corner of said "Tract 2";South 89°18'27" East, passing at a distance of 602.13 feet, the northeast corner of said “Tract 2” and the northwest corner of said “Tract 1”, continuing in all a total distance of 1,780.66 feet to a 5/8-inch iron rod with orange plastic cap stamped “RPLS 4613” found for the most northerly northeast corner of said “Tract 1”;THENCE with an east line of said “Tract 1”, South 01°23'56" East, a distance of 104.04 feet to 5/8-inch iron rod with yellow plastic cap stamped “4613” found for corner;THENCE South 89°17'00" East, a distance of 281.00 feet to a 5/8-inch iron rod with yellow plastic cap stamped RPLS 4857” found for the most easterly northeast corner of said “Tract 1” and being in the west line of a called 120 acre tract of land designated as “First Tract” in the Special Warranty Deed to Victor A. Woodling, JR,recorded in Instrument No. 20100108000023560, Official Public Records, Collin County, Texas;THENCE with the east line of said “Tract 1” and the west line of said 120 acre tract, South 00°44'45" West, a distance of 2,216.64 feet to a 1/2-inch iron rod with yellow plastic cap stamped “RPLS 4613” found for the southeast corner of said “Tract 1” and the southwest corner of said 120 acre tract, and being in the north line of a 30-foot right-of-way dedication for County Road No. 526 according to the plat of ANNA/121 LAND HOLDINGS ADDITION, an addition to Collin County recorded in Instrument No. 20211130010004240, Official Public Records of Collin County, Texas ;STATE OF TEXAS §COUNTY OF COLLIN §NOW, THEREFORE, KNOW ALL MEN BY THESE PRESENTS:THAT G2 MOTORSPORTS PARK, LLC acting herein by and through it's duly authorized officers, does hereby adopt this plat designating the hereinabove described property as G2 MOTORSPORTS PARK ADDITION, an addition to the City of Anna, Texas, and does hereby dedicate, in fee simple, to the public use forever, the streets and alleys shown thereon. The streets and alleys are dedicated for street purposes. The easements and public use areas, as shown, are dedicated for the public use forever, for the purposes indicated on this plat. No buildings, fences, trees, shrubs, or other improvements or growths shall be constructed or placed upon, over, or across the easements as shown, except that landscape improvements may be placed in landscape easements, if approved by the City of Anna. In addition, utility easements may also be used for the mutual use and accommodation of all public utilities desiring to use or using the same unless the easement limits the use to particular utilities, said use by public utilities being subordinate to the public's and City of Anna's use thereof. The City of Anna and public utility entities shall have the right to remove and keep removed all or parts of any buildings, fences, trees, shrubs, or other improvements or growths which may in any way endanger or interfere with the construction, maintenance, or efficiency of their respective systems in said easements. The City of Anna and public utility entities shall at all times have the full right of ingress and egress to or from their respective easements for the purpose of constructing, reconstructing, inspecting, patrolling, maintaining, reading meters,and adding to or removing all or parts of their respective systems without the necessity at any time of procuring permission from anyone.WITNESS, my hand at ______________________, Texas, this the ______ day of ______________, 20______.By: G2 MOTORSPORTS PARK, LLC Name:Title:STATE OF TEXAS §COUNTY OF COLLIN §BEFORE ME, the undersigned, a Notary Public in and for said State, on this day personally appeared known to me to be the person whose name is subscribed to the foregoing instrument and acknowledged to me that he executed the same for the purpose therein expressed and under oath stated that the statements in the foregoing certificate are true.GIVEN UNDER MY HAND AND SEAL OF OFFICE this _____ day of_________________ 20______.Notary Public in and for the State of Texas THENCE with the south lines of said "Tract 1" and said "Tract 2" and the north line of said 30-foot right-of- way dedication, the following courses and distances:South 61°39'58" West, a distance of 86.68 feet to a MAG nail with washer stamped “RPLS 4613” found for corner;South 66°24'20" West, a distance of 71.49 feet to a 1/2-inch iron rod with yellow plastic cap stamped RPLS 4613” found for corner;North 80°16'20" West, a distance of 54.16 feet to a MAG nail with washer stamped “RPLS 4613” found for corner;North 69°31'04" West, a distance of 69.55 feet to a 1/2-inch iron rod with yellow plastic cap stamped RPLS 4613” found for corner;North 79°02'14" West, a distance of 110.20 feet to a 1/2-inch iron rod with yellow plastic cap stamped RPLS 4613” found for corner;North 89°54'47" West, a distance of 342.95 feet to a MAG nail with washer stamped “RPLS 4613” found for corner;North 82°50'57" West, a distance of 71.89 feet to a 1/2-inch iron rod with yellow plastic cap stamped RPLS 4613” found for corner;North 54°18'25" West, a distance of 41.95 feet to a 1/2-inch iron rod with yellow plastic cap stamped RPLS 4613” found for corner;North 43°43'02" West, a distance of 48.65 feet to a 1/2-inch iron rod with yellow plastic cap stamped RPLS 4613” found for corner;North 59°30'55" West, a distance of 65.90 feet to a 1/2-inch iron rod with yellow plastic cap stamped RPLS 4613” found for corner;North 74°10'26" West, a distance of 325.79 feet to a 1/2-inch iron rod with yellow plastic cap stamped RPLS 4613” found for corner;North 81°39'32" West, a distance of 80.54 feet to a 1/2-inch iron rod with yellow plastic cap stamped RPLS 4613” found for corner;South 82°52'42" West, a distance of 135.02 feet to a 1/2-inch iron rod with yellow plastic cap stamped RPLS 4613” found for corner;North 88°45'31" West, a distance of 20.87 feet to a 1/2-inch iron rod with yellow plastic cap stamped RPLS 4613” found for corner;North 00°26'39" East, a distance of 1.67 feet to a 5/8-inch iron rod with red plastic cap stamped "KHA" set for corner;South 88°50'37" West, a distance of 164.88 feet to a MAG nail with washer stamped “RPLS 4613” found for corner;South 84°21'37" West, a distance of 231.25 feet to a MAG nail with washer stamped “RPLS 4613” found for corner;South 89°34'37" West, a distance of 727.50 feet to a MAG nail with washer stamped “ RPLS 4613” found for corner;North 89°36'23" West, a distance of 405.14 feet to a 5/ 8-inch iron rod with red plastic cap stamped "KHA"set for corner at the intersection of the north line of said County Road No. 526 and the northeast right-of-way line of aforementioned Farm-to-Market Road No. 2862;THENCE with the northeast right-of-way line of said Farm-to-Market Road No. 2862, the following courses and distances:North 34°56'00" West, a distance of 30.70 feet to a 1/2-inch iron rod with yellow plastic cap stamped RPLS 4613” found for corner;North 63°36'00" West, a distance of 54.00 feet to a 1/2-inch iron rod with yellow plastic cap stamped RPLS 4613” found for corner;North 41°49'00" West, a distance of 130.00 feet to a 5/8-inch iron rod with red plastic cap stamped "KHA"set for corner;North 45°49'00" West, a distance of 445. 84 feet to an “X” cut in concrete found in the west line of said Tract 2”, and being in the southeast line of said LG MOTORSPORTS PARK ADDITION;THENCE with the southeast, northeast, north and northwest lines of said LG MOTORSPORTS PARK ADDITION, the following courses and distances:North 44°10'59" East, a distance of 437.00 feet to a 1/2-inch iron rod with red plastic cap ( no stamping)found for corner;North 45°49'01" West, a distance of 384.68 feet to a 1/2-inch iron rod with red plastic cap ( no stamping)found for corner;North 88°56'18" West, a distance of 178.55 feet to a 5/8-inch iron rod with red plastic cap stamped "KHA"set for corner;South 44°10'59" West, a distance of 314.95 feet to the POINT OF BEGINNING and containing a computed area of 7, 952,292 square feet or 182. 560 acres of land.MINOR PLAT G2 MOTORSPORTS PARK ADDITION BLOCK A, LOT 1 182.560 ACRES J. CHALMERS SURVEY, ABSTRACT NO. 233 ETJ OF THE CITY OF ANNA COLLIN COUNTY, TEXAS MP 24-0003 SURVEYOR'S STATEMENT:I, David J. De Weirdt, a Registered Professional Land Surveyor, licensed by the State of Texas, affirm that this plat was prepared under my direct supervision, from recorded documentation, evidence collected on the ground during field operations and other reliable documentation; and that this plat substantially complies with the Rule and Regulations of the Texas Board of Professional Engineers and Land Surveyors, and the City of Anna, Texas Date this the _______ day of ________________, 2024.11/22/ 2024 David J. De Weirdt Date Registered Professional Land Surveyor No. 5066 Kimley-Horn and Associates, Inc.13455 Noel Road Two Galleria Office Tower, Suite 700 Dallas, Texas 75240 Ph. (972) 770-1300 david.deweirdt@kimley-horn.com STATE OF TEXAS §COUNTY OF DALLAS §BEFORE ME, the undersigned, a Notary Public in and for said State, on this day personally appeared David J.De Weirdt, known to me to be the person whose name is subscribed to the foregoing instrument and acknowledged to me that he executed the same for the purpose therein expressed and under oath stated that the statements in the foregoing certificate are true.GIVEN UNDER MY HAND AND SEAL OF OFFICE this _____ day of_________________ 20______.Notary Public in and for the State of Texas CERTIFICATE OF APPROVAL APPROVED on this the _____ day of _____________, 20___, by the Planning & Zoning Commission, City of Anna, Texas.Planning & Zoning Commission Chair Director of Development Services PRELIMINARY THIS DOCUMENT SHALL NOT BE RECORDED FOR ANY PURPOSE AND SHALL NOT BE USED OR VIEWED OR RELIED UPON AS A FINAL SURVEY DOCUMENT By: GARAGES OF G2, LLC Name:Title:STATE OF TEXAS §COUNTY OF COLLIN §BEFORE ME, the undersigned, a Notary Public in and for said State, on this day personally appeared known to me to be the person whose name is subscribed to the foregoing instrument and acknowledged to me that he executed the same for the purpose therein expressed and under oath stated that the statements in the foregoing certificate are true.GIVEN UNDER MY HAND AND SEAL OF OFFICE this _____ day of_________________ 20______.Notary Public in and for the State of Texas By:LOUIS (LOU) GIGLIOTTI Name:Title:STATE OF TEXAS §COUNTY OF COLLIN §BEFORE ME, the undersigned, a Notary Public in and for said State, on this day personally appeared known to me to be the person whose name is subscribed to the foregoing instrument and acknowledged to me that he executed the same for the purpose therein expressed and under oath stated that the statements in the foregoing certificate are true. GIVEN UNDER MY HAND AND SEAL OF OFFICE this _____ day of_________________ 20______.Notary Public in and for the State of Texas By:KAREN GIGLIOTTI Name:Title:STATE OF TEXAS §COUNTY OF COLLIN §BEFORE ME, the undersigned, a Notary Public in and for said State, on this day personally appeared known to me to be the person whose name is subscribed to the foregoing instrument and acknowledged to me that he executed the same for the purpose therein expressed and under oath stated that the statements in the foregoing certificate are true.GIVEN UNDER MY HAND AND SEAL OF OFFICE this _____ day of_________________ 20______.Notary Public in and for the State of Texas ENGINEER:KIMLEY- HORN AND ASSOCIATES, INC. 13455 NOEL ROAD TWO GALLERIA OFFICE TOWER, SUITE 700 DALLAS, TEXAS 75240 CONTACT: JEFFREY DOLIAN PH. (972) 770-1300 OWNERS: LOUIS (LOU) GIGLIOTTI;KAREN GIGLIOTTI;G2 MOTORSPORTS PARK, LLC;GARAGES OF G2, LLC;9077 LAKERIDGE DRIVE PRINCETON, TX 75407 CONTACT: LOU GIGLIOTTI PH. (214) 679-8907 HEALTH DEPARTMENT CERTIFICATION I, as a representative of Collin County Development Services, do hereby certify that the on-site sewage facilities described on this plat conform to the applicable OSSF laws of the State of Texas, that site evaluations have been Item No. 10. Planning & Zoning Commission Agenda Staff Report Meeting Date:12/2/2024 Staff Contact:Lauren Mecke AGENDA ITEM: Approve a Resolution regarding the RJ Addition, Block A, Lots 1 & 2, Final Plat. (FP 24- 0016) Owner: Randle Jones SUMMARY: Two single family dwellings on one lot on 2.5± acres on the east side of Farm-to-Market Road 455, 770± feet south of County Road 290. Located in the ETJ. The purpose of the Final Plat is to subdivide the lot into two lots and dedicate utility easements. STAFF RECOMMENDATION: Recommended for approval as submitted. ATTACHMENTS: 1.Locator Map - RJ Addition, Block A, Lots 1 & 2, Final Plat. (FP 24-0016) 2. 3. Resolution - RJ Addition, Block A, Lots 1 & 2, Final Plat. (FP 24-0016) Exhibit A - RJ Addition, Block A, Lots 1 & 2, Final Plat. (FP 24-0016) COUNTY ROAD 290 COUNTYROAD289W FM 455 East ForkTri nit y Ri v er121 5 V a n A l s t y n e 75 SH 121 SH 5 Subject Property City Limits ETJ 0 15030075 Feet November 2024 RJ Addition, Block A, Lots 1 & 2 Final Plat (FP 24-0016) Inset Map CITY OF ANNA, TEXAS PZ RESOLUTION NO. __2024-_____________ A RESOLUTION OF THE CITY OF ANNA, TEXAS APPROVING RJ ADDITION, BLOCK A, LOTS 1 & 2, FINAL PLAT. (FP 24-0016) WHEREAS, In order to provide for the orderly development of land within the Anna city limits and extraterritorial jurisdiction, the City Council of the City of Anna, Texas has adopted Article 9.02 (“Subdivision Regulations”) and Article 9.04 (“Zoning Ordinance”) of the Anna City Code of Ordinances; and WHEREAS, Randle Jones has submitted an application for the approval of RJ Addition, Block A, Lots 1 & 2, Final Plat and WHEREAS, the Final Plat conforms to the City’s Subdivision Regulations; and NOW THEREFORE, BE IT RESOLVED BY THE PLANNING & ZONING COMMISSION OF THE CITY OF ANNA, TEXAS, THAT: Section 1. Recitals Incorporated The recitals above are incorporated herein as if set forth in full for all purposes. Section 2. Approval of Final Plat The Planning & Zoning Commission hereby approves RJ Addition, Block A, Lots 1 & 2, Final Plat attached hereto as Exhibit A. PASSED AND APPROVED by the Planning & Zoning Commission of the City of Anna, Texas, on this 2nd day of December, 2024. ATTEST: APPROVED: Director of Development Services, Planning & Zoning Commission, Chair Stephanie Scott- Sims, AICP Jessica Walden Item No. 11. Planning & Zoning Commission Agenda Staff Report Meeting Date:12/2/2024 Staff Contact:Everett Johnson AGENDA ITEM: Consider/Discuss/Action on a Resolution regarding the Sundstrom Addition, Block A, Lots 1 & 2, Replat (RP 24-0004) Owner: Dave Sundstrom SUMMARY: Two retail/service buildings on two lots on 0.16± acres on the southeast corner of N. Georgia Avenue and W. Houston Street (“Farm-to-Market Road 2862 “). Located in the ETJ. The lots are located in the historical Old Donation section of Westminster. The purpose of the replat is to combine four lots into two lots. However, because the lots predate the adoption of the City’s Ordinances, the lots do not meet all requirements of the City’s Subdivision Ordinance, specifically the requirements related to building setback and wastewater service. The lots do not have wastewater connections. In order to combine the lots, the applicant is requesting a waiver from the following Subdivision Ordinance requirements: Sec. 9.02.088(c) - Requirements in Extraterritorial Jurisdiction For property that is within the City’s extraterritorial jurisdiction, the minimum front building line for all lots (residential or nonresidential) shall be 25 feet. Sec. 9.02.088 - Water and Wastewater Facility Design - as it pertains to wastewater a) Connections for Water All new subdivisions shall be connected with the City’s water system or other public water supply system approved by TCEQ. The water system shall be capable of providing water for health and emergency purposes, including fire protection. The design and construction of water system shall comply with the following standards: 1) Applicable regulations of the Texas Commission on Environmental Quality TCEQ). 2) Standards in the City’s design standards. 3) Fire protection and suppression standards in accordance with the City’s policies and ordinances including fire code adopted by the City. b) Connections for Wastewater 1) All new subdivisions shall be served by a wastewater collection and treatment system authorized and permitted by the TCEQ, except as provided below. The design and construction of the wastewater system improvements shall be in accordance with the standards in the City’s design standards, and in accordance with TCEQ standards. 2) On-site sewage facilities such as septic or aerobic systems may be permitted by the Commission and City Council in subdivisions where each lot is one acre or more in area, if the subdivision is 1,000 feet or more from a connection to a wastewater collection system. The approval of an on-site sewage disposal facility by the Commission and City Council is not mandatory but rather discretionary. 3) Exceptions to the lot size regulations in subsection (2) above may be approved by the Commission and City Council for properties existing on the effective date of these subdivision regulations that are less than one acre, and for residential cluster or conservation developments that group residential properties in the proposed subdivision closer together and that preserve at least 1/2 of the land in the subdivision for open space, recreation or agriculture. c) Subdivider Responsibilities The subdivider shall be responsible for the following: 1) Phasing of development or improvements in order to maintain adequate water and wastewater services; 2) Extensions of utility lines (including any necessary on-site and off-site lines) to connect to existing utility mains of adequate capacity; 3) Providing and/or procuring all necessary easements for the utilities (whether on- site or off-site); 4) Providing proof to the City of adequate water and wastewater service; 5) Providing for future expansion of the utilities if such will be needed to serve future developments, subject to the City’s oversize participation policies (refer to sections 9.02.004 and 9.02.011 and section 9.02.202(c) of this article for information on adequate facilities and proportionality of developer participation), if applicable; 6) Providing all operations and maintenance of the private utilities, or providing proof that a separate entity will be responsible for the operations and maintenance of the utilities; 7) Providing all fiscal security required for the construction of the utilities; 8) Obtaining approvals from the applicable utility providers if other than the City; and 9) Complying with all requirements of the utility providers, including the City. d) Location of Lines Extension of water and wastewater lines shall be made along the entire frontage of the subdivision adjacent to a street or thoroughfare in rights-of-way or dedicated easements. 1) If the subdivision is not adjacent to a thoroughfare, the extension of utilities shall be accomplished in such a manner as to allow future connections to said utilities by new subdivisions. 2) If new subdivisions are not likely to be developed beyond the proposed subdivision (due to physical constraints), the Director of Development Services and City Engineer may waive the requirement for adjacent utility line construction at the time of preliminary plat approval and prior to construction of the subdivision. 3) The City shall determine the location and routing of water and sewer extensions and shall retain the authority to reject any extension not deemed to be in the best interest of the City. e) Utilities Not Specified Installation, operations and maintenance of utilities not specifically referenced herein shall comply with regulations of the TCEQ and with any other applicable state rules and regulations, whichever is the most stringent. f) Dead-End Water Lines 1) Dead-end water lines should be avoided, but when deemed necessary, they should be extended to, and then through, the property sought to be subdivided. 2) All dead-end water lines shall be valved and provided with a valve and fire hydrant located at the extreme end of the line instead of the blow-off mechanism for their flushing, in accordance with current City standard specifications. g) Payment of Pro-Rata Charges Where the proposed subdivision would abut and utilize an existing water main and/or sanitary sewer main of the City, the developer shall pay to the City any applicable pro-rata” charge per requirements of the City or previous pro-rata agreement. STAFF RECOMMENDATION: Recommended for approval subject to Waivers from the following Subdivision Ordinance requirements: 1. Sec. 9.02.088(c) - Requirements in Extraterritorial Jurisdiction 2. Sec. 9.02.088 - Water and Wastewater Facility Design - as it pertains to wastewater ATTACHMENTS: 1.Locator Map - Sundstrom Addition, Block A, Lots 1 & 2, Replat (RP 24-0004) 2. 3. 4. Resolution - Sundstrom Addition, Block A, Lots 1 & 2, Replat (RP 24-0004) Exhibit A - Sundstrom Addition, Block A, Lots 1 & 2, Replat (RP 24-0004) Waiver Letter - Sundstrom Addition, Block A, Lots 1 & 2, Replat (RP 24-0004) E HOUSTON ST SGEORGIAAVENCHURCHSTBRO ADW AYAVES U N S ET DR W HOUSTON ST WELL STW PUBLIC RD SCOLLEGEAVEW AUSTIN ST SCHURCHSTW BAILEY ST NCOLLEGEAVEPRIVATEROAD 5692SBOWDENAVEN BOWDEN AVEPICCADILLY AVENGEORGIAAVEE BAILEY ST E PUBLIC RD E AUSTIN ST East ForkTr i n it y R i v er121 V a n A l s t y n e 75 SH 121 SH 5 Subject PropertyCity Limits ETJ 0 300 600150 Feet November 2024 C:\Users\cbrooks\OneDrive - City of Anna\ GIS\Notification Maps\Notification Maps\Sundstrom Addition, Block A, Lots 1 & 2 Replat ( CITY OF ANNA, TEXAS RESOLUTION NO. _______________ A RESOLUTION OF THE CITY OF ANNA, TEXAS APPROVING SUNDSTROM ADDITION, BLOCK A, LOTS 1 & 2, REPLAT (RP 24-0004) WHEREAS, In order to provide for the orderly development of land within the Anna city limits and extraterritorial jurisdiction, the City Council of the City of Anna, Texas has adopted Article 9.02 (“Subdivision Regulations”) and Article 9.04 (“Zoning Ordinance”) of the Anna City Code of Ordinances; and WHEREAS, Dave Sundstrom has submitted an application for the approval of Sundstrom Addition, Block A, Lots 1 & 2, Replat; and WHEREAS, the Replat conforms to the City’s Subdivision Regulations; and NOW THEREFORE, BE IT RESOLVED BY THE CITY COUNCIL OF THE CITY OF ANNA, TEXAS, THAT: Section 1. Recitals Incorporated The recitals above are incorporated herein as if set forth in full for all purposes. Section 2. Approval of Replat The City Council hereby approves Sundstrom Addition, Block A, Lots 1 & 2, Replat attached hereto as Exhibit A. PASSED AND APPROVED by the City Council of the City of Anna, Texas, on this 14th day of January, 2025. ATTEST: APPROVED: Carrie Land, City Secretary Pete Cain, Mayor Per Plat of Record in Vol. 81, Pg. 382, D.R./C.C. Tx. Original Donation to the Town of Westminister, Texas L3941P S SE R NAL D OF RE NOVURSI YOAS O WILLIAM DAVISFINNEYIETGARTSESAXTETERE D F THESE LOTS ARE WITHIN ZONE 'X', (UNSHADED), AREAS DETERMINED TO BE OUTSIDE THE 0.2% ANNUAL CHANCE FLOODPLAIN, PER FEMA FLOOD INSURANCE RATE MAP FOR COLLIN COUNTY, TEXAS AND INCORPORATED AREAS, MAP NUMBER 48085C0180J, EFFECTIVE DATE: JUNE 2, 2009. THIS FLOOD STATEMENT DOES NOT IMPLY THAT THE PROPERTY AND / OR STRUCTURES THEREON WILL BE FREE FROM FLOODING OR FLOOD DAMAGE ON RARE OCCASIONS. GREATER FLOODS CAN AND WILL OCCUR AND FLOOD HEIGHTS MAY BE INCREASED BY MAN-MADE OR NATURAL CAUSES. THIS FLOOD STATEMENT SHALL NOT CREATE LIABILITY ON THE PART OF THE SURVEYOR. GENERAL NOTES: O.P.R./C.C.Tx. = Official Public SIR = Set 1/2 Inch Rod with a Cap Stamped 3941 GW = Guy Wire Anchor Records Collin County, Texas. LEGEND: D.R./C.C.Tx. = Deed Records Collin County, TexasN. Georgia AvePER ALLTERRA CENTRAL INC. NETWORK PC = Plat Calls LINKED WITH TRIMBLE RTK GPS RECEIVER TEXAS NORTH CENTRAL ZONE 4202 ( CONUS)GRID NORTH U. S. STATE PLANE 1983 BASIS OF BEARINGS:Lot 13 FIR = Found 1/2" IronRod10' AlleyMetal Fence Vol. 1076, Pg. 137, D.R./ C.C. Tx.Clerk' s Instrument NumberWILLIAM E. ANDERSON et ux PATSYFRANKIE JOE FELL JR. & DANE SUNDSTROM2024000035447, O.P.R./ C.C. Tx. 03/26/2024Asphalt PavementR- O-W ( Called) 50' PP = Power Pole Houston Street Lot14 Lot15 Lot 16 All of Lot 16, Lot 15 S 15' of Lot 14 S 89° 50' 00" E 69.02'S 89° 50' 00" E 69.03'100. 16'N 00° 22' 19" W100. 12'S00° 23' 17" E69. 04'N 89° 51' 53" W H O2Valve H O2Meter PP PP PP PP Gas Sign 60.11'40.05'60.11'40.01'Lot 26Austin Street R-O-W ( Called) 50' R-O-W (Called) 50'4150 Sq. Ft. or 0.095 Acre 2764 Sq. Ft.or 0.064 Acre #109 E. Houston Str, Anna, Texas 75409Asphalt Pavement Overhead Electrical LinesOverhead Electrical LinesMailboxesCulvert#100 Georgia Str.110 Georgial Str.N 10' of Lot 14 All of Lot 13 SIR SIR SIR FIR w/Cap Stamped Burns FIR w/Cap Stamped Burns FIR w/Cap Stamped Burns OWNERS DEDICATION NOW THEREFORE, KNOW ALL MEN BY THESE PRESENTS:THAT, Frankie Joe Fell Jr. and Dane Sundstrom, do hereby adopt this plat designating the herein above described property as Sundstrom Addition, Block A, Lots 1 & 2, being a replat of Lots 13, 14, 15, & 16, of The Town of Westminster Original Donation, Per Plat recorded in Volume 81, Page 382, Deed Records Collin County, Texas, an addition to the ETJ of the City of Anna, Texas, and does hereby dedicate, in fee simple, to the public use forever, the streets alleys shown hereon. The street and alleys are dedicated for street purposes. The easements and public use areas, as shown, are dedicated for public use forever, for the purposed indicated on this plat. No buildings, fences, trees, shrubs,or other improvements or growths shall be constructed or placed upon, over, or across the easements as shown, except that landscape improvements may be placed in landscape easements, if approved by the City of Anna. In addition, utility easements may also be used for the mutual use and accommodation of all public utilities desiring to use or using the same unless the easement limits the use to particular utilities, said use by public utilities being subordinate to the public's and City of Anna's use thereof. The City of Anna and public utility entities shall have the right to remove and keep removed all or parts of any buildings, fences, trees, shrubs, or other improvements or growths which may in any way endanger or interfere with the construction, maintenance, or efficiency of their respective systems in said easements. the City of Anna and public utilities entities shall at all times have the full right of ingress and egress to or from their respective easements for the purpose of constructing, reconstructing, inspecting,patrolling, maintaining, reading meters, and adding to or removing all or parts or their respective systems without the necessity at any time of procuring permission from anyone. This plat approved subject to all Platting Ordinances, Rules, Regulations and Resolutions of the City of Anna, Texas Witnees my hand this ____________ day of ____________ 2024 By: Frankie Joe Fell Jr. By: Dane Sundstrom STATE OF TEXAS COUNTY OF COLLIN Before me, the undersigned authority, on this day personally appeared Dane Sundstrom,known to me to be the person whose name is subscribed to the foregoing instrument and acknowledged to me that he executed the same for the purposes and consideration therein expressed, and in the capacity therein stated.Given under my hand and seal of office, this __________ day of 2024 Notary Public in and for State of Texas SURVEYOR' S STATEMENT:I, William Davis Finney, a Registered Professional Land Surveyor, licensed by the State of Texas, affirm that this plat was prepared under my supervision, from recorded documentation, evidence collected on the ground during field operations and other reliable documentation; and that this plat substantially complies with the Rules and Regulations of the Texas Board of Professional Engineers and Land Surveyors, the City of Anna Development Code and the Texas Local Government Code, Chapter 212. I further affirm that monumentation shown hereon was either found or placed in compliance with the City of Anna Development Code, and that the digital drawings files accompanying this plat is a precise representation of this Signed Final Plat.Dated this the ____________ day of _______________, 2024 William Davis Finney Texas Registered Professional Land Surveyor Number 3941 STATE OF TEXAS COUNTY OF COLLIN Before me, the undersigned authority, on this day personally appeared William Davis Finney,known to me to be the person whose name is subscribed to the foregoing instrument and acknowledged to me that he executed the same for the purposes and consideration therein expressed, and in the capacity therein stated.Given under my hand and seal of office, this __________ day of 2024 Notary Public in and for State of Texas CERTIFICATE OF APPROVAL APPROVED on this the __________ day of _______________ 20___, by the City Council, City of Anna, Texas Mayor City Secretary REPLAT SUNDSTROM ADDITION BEING A REPLAT OF LOTS 13, 14, 15, & 16 OF WESTMINISTER, COLLIN COUNTY, TEXAS OF THE ORIGINAL DONATION TO THE TOWN BEING A PLAT OF 0. 159 ACRE SITUATED IN THE JOHN ROLAND SURVEY, ABSTRACT NUMBER 784 COLLIN COUNTY, TEXAS OCTOBER 24, 2024 SURVEYOR WILLIAM DAVIS FINNEY TX.R.P.L.S. #3941 DATA LAND SERVICES CORPORATION TBPE&LSFRL NO. 10183900 P. O. BOX 2110 FORNEY, TEXAS 75126 903) 532-6228 (972) 564-6166 BLOCK 'A', LOTS 1 & 2 OWNERS FRANKIE JOE FELL JR.DANE SUNDSTROM 2618 KATIE TRAIL MELISSA, TX 75454-2510 108 CHALK ROAD ANNA, TX 75409-5463 OWNER'S CERTIFICATE STATE OF TEXAS COUNTY OF COLLIN ALL THAT CERTAIN TRACT OR PARCEL OF LAND LYING AND BEING SITUATED IN THE JOHN ROLAND SURVEY, ABSTRACT NUMBER 784, IN COLLIN COUNTY, TEXAS, BEING LOTS 13, 14, 15, & 16, OF THE ORIGINAL DONATION, AN ADDITION TO THE TOWN OF WESTMINISTER, COLLIN COUNTY, TEXAS, AS SHOWN BY PLAT OF RECORD IN VOLUME 81, PAGE 382, DEED RECORDS OF COLLIN COUNTY, TEXAS, BEING THE ALL OF THE TRACTS CONVEYED TO FRANKIE JOE PELL JR, AND DANE SUNDSTROM, BY DEED RECORDED IN CLERK'S INSTRUMENT NUMBER 2024000035447, OFFICIAL PUBLIC RECORDS COLLIN COUNTY, TEXAS, AND BEING MORE PARTICULARLY DESCRIBED AS FOLLOWS:BEGINNING AT THE NORTHWEST CORNER OF SAID LOT 16 AND SAID TRACT #1, A 1/2 INCH IRON ROD WITH A CAP STAMPED 3941, SET AT THE INTERSECTION OF THE SOUTH LINE OF HOUSTON STREET (50' WIDE R-O-W) WITH THE EAST LINE OF GEORGIA AVENUE ( 50' WIDE R-O-W);THENCE SOUTH 89 DEGREES 50 MINUTES 00 SECONDS EAST, WITH THE SOUTH LINE OF HOUSTON STREET, AND THE NORTH LINE OF SAID LOT 16 AND SAID TRACT #1, A DISTANCE OF 69.02 FEET TO A 1/2 INCH IRON ROD WITH A CAP STAMPED BURNS, FOUND AT THE NORTHEAST CORNER OF LOT 16, ON THE WEST LINE OF A 10 FEET WIDE ALLEY;THENCE SOUTH 00 DEGREES 23 MINUTES 17 MINUTES EAST, WITH THE EAST LINE OF SAID LOTS 16, 15, 14, AND 13, AND THE WEST LINE OF SAID ALLEY A DISTANCE OF 100.12 FEET, TO A 1/2 INCH IRON ROD WITH A CAP STAMPED BURNS, FOUND AT THE SOUTHEAST CORNER OF SAID LOT 13, ON THE NORTH R-O- W OF AUSTIN STREET;THENCE NORTH 89 DEGREES 51 MINUTES 53 SECONDS WEST, WITH THE SOUTH LINE OF SAID LOT 13, AND THE NORTH R-O-W LINE OF AUSTIN STREET, A DISTANCE OF 69.04 FEET TO A 1/2 INCH IRON ROD WITH A CAP STAMPED BURNS, FOUND AT THE INTERSECTION OF THE NORTH LINE OF AUSTIN STREET (50' WIDE R-O-W) WITH THE EAST LINE OF GEORGIA AVENUE (50' WIDE R-O-W);THENCE NORTH 00 DEGREES 22 MINUTES 19 SECONDS WEST, WITH THE WEST LINE OF SAID LOTS 13, 14, 15, & 16, AND THE EAST LINE OF SAID GEORGIA AVENUE, A DISTANCE OF 100.16 FEET, TO THE POINT-OF-BEGINNING, AND CONTAINING IN ALL 6913 SQUARE FEET OR 0.159 ACRE OF LAND.STATE OF TEXAS COUNTY OF COLLIN Before me, the undersigned authority, on this day personally appeared Frankie Joe Fell Jr., known to me to be the person whose name is subscribed to the foregoing instrument and acknowledged to me that he executed the same for the purposes and consideration therein expressed, andin the capacity therein stated.Given under my hand and seal of office, this __________ day of 2024 Notary Public in and for State of Texas 0 10 30 50 80 GRAPHIC SCALE: 1" = 20'VICINITY MAP NOT TO SCALE FM 2862 Bailey St.Houston St.Austin St. Co. Rd. 525 Sunset Dr.Co. R. 526 Westminister, Tx.Adventure WayPecan Hollow Circle S. Church St.Sterling Dr.White OakCir.FM 3133Westmoreland Cir.Co. Rd. 511Houston St.Georgia AveCollege St.SiteWESTMINISTER TOWN SQUARE (Per Plat)Lot 1Lot 2Lot 17 Lot 12Lot 11Lot 25 Lot 2 Lot 1 BLOCK ' A'1. The purpose of the RePlat is to modify the Lot widths from the Original Donation Plat.2. Basis of Bearings is Grid North U. S. State Plane 1983, Texas North Central Zone 4202 (Consus)Per Allterra Central Inc. Network Item No. 12. Planning & Zoning Commission Agenda Staff Report Meeting Date:12/2/2024 Staff Contact:Lauren Mecke AGENDA ITEM: Conduct a Public Hearing/Consider/Discuss/Action on an Ordinance to amend an existing Planned Development (Ord. No. 648-2014) to allow for a commercial drone delivery hub on 4,770± square feet, located on the west side of S. Buddy Hayes Boulevard, 265± feet north of W. White Street. Zoned Planned Development (Ord. No. 648-2014). (PD 24-0005) Owner: Matt Philpott (Walmart Sr. Project Manager) SUMMARY: A retail store building on one lot on 18.5± acres, on the west side of S. Buddy Hayes Boulevard, 265± feet north of W. White Street. Zoned Planned Development (Ord. 648- 2014). History: Ordinance No. 120-2003 – Annexed and zoned 98.2± acres to Planned Development with modified C-2 uses. December 9, 2003. Ordinance No. 121-2003 – Annexed and zoned 9.1± acres to Planned Development with modified C-2 uses. December 9, 2003. Ordinance No. 648-2014 - Rezoned by repeal of Ordinance No. 120-2003 and Ordinance No.121-2003 and replaced with Planned Development zoning with modified C-2 uses and standards. January 28, 2014. Case Overview The applicant is proposing to add a commercial drone delivery hub as an accessory use to the retail store. Staff mailed public hearing notices to surrounding property owners in accordance with state law. To date, Staff has not received any input comments on this case. Direction Land Use Zoning Comprehensive Plan North Vacant Zoned PD (Ord. 648- 2014) Regional Activity Center East Vacant lot and Hotel Zoned PD (Ord. 648- 2014) Urban Living South Four commercial/retail lots Zoned PD (Ord. 648- 2014) Regional Activity Center West Three restaurant and restaurant/retail lots Two zoned PD (Ord. 648-2014), and one zoned PD (Ord. 648- 2014 & Ord. 826-2019) Regional Activity Center Compatibility Considerations This request will not change the base zoning, Regional Commercial (C-2), of the Planned Development and is generally in conformance with the Anna 2050 Comprehensive Plan. The Zoning Ordinance does not currently address the emerging technology of drone delivery. Staff researched standards used by other Texas cities and are proposing the following: Restricting the outdoor storage location to the equipment area as shown on the site plan associated with this request. Restricting the area for outdoor storage to a maximum of 5,000 square feet. Establishing screening standards: o A minimum 8-foot-tall black ornamental screen with unobstructed view shall be provided around all outdoor storage areas.. Requiring additional landscaping to provide screening from the equipment: o . Additional trees within or adjacent to the landscape buffer shall be provided along Buddy Hayes Boulevard to create a screening effect of the commercial drone delivery hub equipment and must contain: One (1) canopy tree per 40 linear feet of street frontage and One (1) ornamental tree per 20 linear feet of fencing The applicant is not requesting to reduce or remove parking spaces from the site. Proposed location of the commercial drone delivery hub: Current aerial image and selection from site plan. STAFF RECOMMENDATION: Staff recommends approval as presented in the attached Ordinance. ATTACHMENTS: 1. Locator Map - Walmart Anna Addition, Block A, Lot 1 Zoning 2. Ordinance - Walmart Anna Addition, Block A, Lot 1 3. Exhibit A - Walmart Anna Addition, Block A, Lot 1, Legal Description 4.Exhibit B - Walmart Anna Addition, Block A, Lot 1, Site Plan PARKVIEW DR PINE KNOLLWAYSTANLEYFALLSDRN CENTRALEXPYHAWTHORNE RDSCENTRALEXPYUS HIGHWAY 75HELMOKEN FALLS DR HANAKOA FALLS DR ATHABASCA FALLS DR TANUR CASCADE DR H A R D W O O D CTCOTTONWOODTRLPENTONLINNS DRCREEKMEADOW CTLAKESHORE DR HILLSIDE DR CREEKMEADOWDRTRA ILW OO D D R CEDAR TRL W WHITEST OLDWARRIOR RDWILEY FARMNBUDDYHAYESBLVDSPRINGVALLEYWAYSUZIELNSBUDDYHAYESBL V D HILLTOPDRCREEKSIDEDRCREEKVIEWDRNIAGARAFALLSDRHARDWOODT RL HACKBERRY DR WI NDI NGCREEKL NTIMBER RIDGE DR S S T A N D R ID G E B L V DPERSI MMONDREast ForkTr i n it y R i v er121 V a n A l s t y n e 75 SH 121 SH 5 Subject Property 200' Notice Boundary City LimitsETJ 0 500 1, 000250 Feet November 2024 C:\Users\cbrooks\OneDrive - City of Anna\GIS\ Notification Maps\ Notification Maps\Anna Walmart Zoning (PD 24-0005)Inset Map Walmart Anna Addition, Block A, Lot 1 1 CITY OF ANNA, TEXAS Property zoned under this ordinance is generally located on the west side of Buddy Hayes Boulevard, 265± feet north of W. White Street ORDINANCE NO. ________________ AN ORDINANCE OF THE CITY OF ANNA, TEXAS AMENDING THE CITY’S COMPREHENSIVE PLAN, ZONING MAP, AND ZONING ORDINANCE AND CHANGING THE ZONING OF CERTAIN PROPERTY AS DESCRIBED HEREIN; PROVIDING FOR SAVINGS, REPEALING AND SEVERABILITY CLAUSES; PROVIDING FOR AN EFFECTIVE DATE; PROVIDING FOR A PENALTY CLAUSE NOT TO EXCEED $2,000 OR THE HIGHEST PENALTY AMOUNT ALLOWED BY LAW, WHICHEVER IS LESS; AND, PROVIDING FOR THE PUBLICATION OF THE CAPTION HEREOF. WHEREAS, the City of Anna, Texas (“City”) has previously adopted ordinances, rules and regulations governing the zoning in the City; and WHEREAS, the City has received a request to amend the zoning and development regulations in Ordinance No. 648-2014 as amended from Matt Philpott (Walmart Sr. Project Manager) on Property described and depicted in Exhibit 1 (“Property”) attached hereto and incorporated herein for all purposes as if set forth in full; and WHEREAS, the Planning and Zoning Commission of the City and the City Council of the City of Anna (“City Council”) have given the requisite notices by publication and otherwise and have held the public hearings as required by law and afforded a full and fair hearing to all property owners and generally to all persons interested in and situated in the affected area and in the vicinity thereof, the City Council has concluded that the Zoning Ordinance of the City should be amended as set forth below. NOW, THEREFORE, BE IT ORDAINED BY THE CITY COUNCIL OF THE CITY OF ANNA, TEXAS THAT: Section 1.Recitals Incorporated The above recitals are incorporated herein by reference for all purposes. Section 2.Zoning Ordinance Amended The Anna City Code of Ordinances (the “Anna Code”) and Planned Development (Ord. No. 648-2014) are hereby amended by amending the zoning of the Property as described on the attached Exhibit A and depicted on the attached Exhibit B. 1. Purpose. The purpose of this Planned Development amendment is to add an accessory use of commercial drone delivery hub to the existing retail building site. 2 2. Definitions. Except as otherwise provided herein, the definitions in Appendix 3 of the City’s Zoning Ordinance shall apply. Commercial drone delivery hub – An area of land, structural surface, building, or structure with one or more designated drone staging areas for use by small unmanned aircraft systems (sUAS) under 55 pounds total take-off weight or as defined in Section 44801 of Title 49, United States Code, as amended, whichever is the lesser, to distribute commercial goods by air. This includes any appurtenant areas used or intended for use for unmanned aircraft system buildings, structures, and other facilities. 3. Development Standards. A. The location of the commercial drone delivery hub shall be designated on an approved site plan and shall not be placed: 1. Within any required building setbacks; 2. Within any required landscape edge; 3. Within fire lanes, easements, maneuvering aisles, customer pick-up lanes, or required loading zones and parking spaces; or 4. So as to obstruct visibility or interfere with pedestrian or vehicle circulation. B. Standards and Area Regulations: Development must comply with the development standards for use, density, lot area, lot width, lot depth, yard depths and widths, building height, building elevations, coverages, floor area ratio, parking, access, screening, landscaping, accessory buildings, signs, and lighting, set forth in the Regional Commercial (C-2) zoning district and the Planning and Development Regulations except as modified per Ord. No. 648-2014 and as otherwise specified herein. 1. Retail standards: i. Commercial drone delivery hub is permitted as an accessory use on Walmart Anna Addition, Block A, Lot 1. 2. Commercial drone delivery hub standards: i. Commercial drone delivery hub area shall not exceed 5,000 square feet. ii. Screening: A minimum eight-foot-tall (8’) black ornamental screen shall be provided around all outdoor storage areas. 3 iii. Additional landscaping within or adjacent to the landscape buffer shall be provided along Buddy Hayes Boulevard to create a screening effect of the commercial drone delivery hub equipment and must contain: 1. One (1) canopy tree per 40 linear feet of street frontage and 2. One (1) ornamental tree per 20 linear feet of fencing around the commercial drone delivery hub. iv. Parking: No additional parking spaces are required. Section 3.Official Zoning Map The official Zoning Map of the City shall be corrected to reflect the change in zoning described herein. Section 4.Savings, Repealing and Severability Clauses It is hereby declared to be the intention of the City Council that the words, sentences, paragraphs, subdivisions, clauses, phrases, and provisions of this ordinance are severable and, if any phrase, sentence, paragraph, subdivision, clause, or provision of this ordinance shall be declared unconstitutional or otherwise invalid or inapplicable by the valid judgment or decree of any court of competent jurisdiction, such unconstitutionality, invalidity or inapplicability shall not affect any of the remaining words, sentences, paragraphs, subdivisions, clauses, phrases, or provisions of this ordinance, since the same would have been enacted by the City Council without the incorporation in this ordinance of any such unconstitutional, invalid or inapplicable words, sentences, paragraphs, subdivisions, clauses, phrases, or provisions. Further, all ordinances or parts of ordinances in force when the provisions of this ordinance become effective that are consistent and do not conflict with the terms and provisions of this ordinance are hereby ratified to the extent of such consistency and lack of conflict, and all ordinances or parts of ordinances in force when the provisions of this ordinance become effective that are inconsistent or in conflict with the terms and provisions contained in this ordinance are hereby repealed only to the extent of any such conflict. Notwithstanding any provision of this ordinance or the Anna Code, it is intended that this ordinance fully comply with Chapter 3000 of the Texas Government Code (“Chapter 3000”) and this ordinance shall and the City Code shall be interpreted in a manner to comply with Chapter 3000. For the purposes of this ordinance, any provision of the City Code that does not comply with Chapter 3000 shall be deemed to have been excluded and not a part of this ordinance. Section 5.Penalty Any violation of any of the terms of this ordinance, whether denominated in this ordinance as unlawful or not, shall be deemed a misdemeanor. Any person convicted of any such violation 4 shall be fined in an amount not to exceed $2,000 for each incidence of violation. Each day a violation exists is considered a separate offense and will be punished separately. Section 6.Publication of the Caption and Effective Date This ordinance shall be effective upon its passage by the City Council, approval by the Mayor, and posting and/or publication, if required by law, of its caption. The City Secretary is hereby authorized and directed to implement such posting and/or publication. PASSED by the City Council of the City of Anna, Texas this 14th day of January 2025. ATTESTED: APPROVED: Carrie L. Land, City Secretary Pete Cain, Mayor Legal description of the land BEING a tract of land situated in the Thomas Ratton Survey, Abstract No. 782, and the W.S. Ratton Survey, Abstract No. 752, City of Anna, Collin County, Texas, and being all of a called 18.551 acre tract of land described in the deed to Wal-Mart Real Estate Business Trust, recorded in Instrument No. 20150602000647410, Real Property Records of Collin County, Texas, and a portion of a called 107.52 acre tract of land described in the deed to Q Seminole Anna Town Center, L.P., recorded in Instrument No. 20080128000100640, said Real Property Records, and being more particularly described as follows: BEGINNING at a 5/8 inch iron rod with plastic cap stamped with "KHA" set for the southeast corner of said 18.551 acre tract and on the northerly line of F.M. 455 (White Road), from which the southeast corner of said 107.52 acre tract bears North 88°02'21" East a distance of 240.37 feet, South 86°53'28" East a distance of 211.81 feet, and South 79°25'49" East a distance of 46.42 feet, said southeast corner of said 107.52 acre tract being monumented by a 1/2 inch iron rod that bears North 00°14' East a distance of 0.36 feet; THENCE South 88°02'21" West, along the southerly line of said 18.551 acre tract and along the northerly right-of-way line of F.M. 455, a distance of 169.65 feet to 1/2 inch iron rod with plastic cap stamped "GEER 4117" found for corner; THENCE South 85°33'01" West, continuing along the southerly line of said 18.551 acre tract and along the northerly right-of- way line of F.M. 455, a distance of 1.24 feet to a 5/8 inch iron rod with plastic cap stamped with "KHA" set for the southern -most southwest corner of said 18.551 acre tract, from which an aluminum TxDOT right-of-way monument found at the southern-most southwest corner of said 107.52 acre tract bears South 87°15'24" West a distance of 182.35 feet; THENCE North 1°56'25" West, departing the northerly right-of-way line of F.M. 455, along a westerly line of said 18.551 acre tract, a distance of 287.52 feet to a 5/8 inch iron rod with plastic cap stamped with "KHA" set for corner; THENCE North 89°46'13" West, along a southerly line of said 18.551 acre tract, a distance of 215.11 feet to a 5/8 inch iron rod with plastic cap stamped with "KHA" set for corner at the beginning of a tangent curve to the right having a central angle of 45°24'44", a radius of 360.50 feet, a chord bearing and distance of North 67°03'51" West, 278.31 feet; THENCE in a northwesterly direction, continuing along a southerly line of said 18.551 acre tract, and with said curve to the right, an arc distance of 285.73 feet to a 5/8 inch iron rod with plastic cap stamped with "KHA" set for corner at the end of said curve; THENCE South 53°03'11" West, continuing along a southerly line of said 18.551 acre tract, a distance of 99.23 feet to a 5/8 inch iron rod with plastic cap stamped "KHA" set for corner at the beginning of a tangent curve to the right having a central angle of 04°31'07", a radius of 546.50 feet, a chord bearing a distance of South 55°18'44" West, 43.09 feet; THENCE in a southwesterly direction, continuing along a southerly line of said 18.551 acre tract, and with said curve to the right, an arc distance of 43.10 feet to a 5/8 inch iron rod with plastic cap stamped "KHA" set for corner at the end of said curve; THENCE South 57°34'17" West, continuing along a southerly line of said 18.551 acre tract, a distance of 151.77 feet to a 5/8 inch iron rod with plastic cap stamped with "KHA" set for a salient corner on the westerly line of said 18.551 acre tract, and on the easterly right-of- way line of U.S. Highway 75, from which an aluminum TxDOT right-of-way monument found at an angle point in said right-of-way line bears South 33°05'36" East a distance of 185.18 feet; THENCE North 33°05'36" West, along the westerly line of said 18.551 acre tract and along the easterly right-of-way line of U.S. Highway 75, a distance of 57.00 feet to a 5/8 inch iron rod with plastic cap stamped with "KHA" set for a salient corner on the westerly line of said 18.551 acre tract; THENCE North 57°34'17" East, departing the easterly right-of-way line of U.S. Highway 75, continuing along the westerly line of said 18.551 acre tract, a distance of 152.43 feet to a 5/8 inch iron rod with plastic cap stamped "KHA" set for corner at the beginning of a tangent curve to the left having a central angle of 04°31'07", a radius of 489.50 feet, a chord bearing and distance of North 55°18'44" East, 38.59 feet; THENCE in a northeasterly direction, continuing along the westerly line of said 18.551 acre tract, and with said curve to the left, an arc distance of 38.60 feet to a 5/8 inch iron rod with plastic cap stamped "KHA" set for corner at the end of said curve; THENCE North 53°03'11" East, continuing along the westerly line of said 18.551 acre tract, a distance of 96.37 feet to a 5/8 inch iron rod with plastic cap stamped with "KHA" set for corner at the beginning of a non-tangent curve to the right having a central angle of 35°30'28", a radius of 360.50 feet, a chord bearing and distance of North 17°31'27" West, 219.85 feet; THENCE in a northwesterly direction, continuing along the westerly line of said 18.551 acre tract, and with said curve to the right, an arc distance of 223.41 feet to a 5/8 inch iron rod with plastic cap stamped with "KHA" set for corner at the end of said curve; THENCE North 0°13'47" East, continuing along the westerly line of said 18.551 acre tract, a distance of 363.50 feet to a 5/8 inch iron rod with plastic cap stamped with "KHA" set for corner; THENCE North 89°46'13" West, continuing along the westerly line of said 18.551 acre tract, a distance of 207.53 feet to a 5/8 inch iron rod with plastic cap stamped with "KHA" set for corner on the proposed easterly right-of-way line of U.S. Highway 75 according to Notice of Lis Pendens, recorded in Instrument No. 20150331000350710, said Real Property Records, which discloses a certain Petition in an eminent domain proceeding numbered 002 -00750- 2015 and styled The State of Texas v. Q Seminole Anna Town Center, LP, a Texas Limited Partnership, et al.; THENCE North 7°36'50" East, continuing along the westerly line of said 18.551 acre tract, and along said proposed easterly right-of-way line of U.S. Highway 75, a distance of 50.92 feet to a 5/8 inch iron rod with plastic cap stamped with "KHA" set for the western-most northwest corner of said 18.551 acre tract, from which a 1/2 inch iron rod with plastic cap stamped "GEER 4117" found at the northwest corner of said 107.52 acre tract, bears North 89°46'13" West a distance of 39.78 feet, North 10°28'35" East a distance of 546.22 feet, North 06°10'54" East a distance of 200.06 feet, North 07°36'50" a distance of 1400.00 feet, North 05°27'50" East a distance of 400.28 feet, and North 10°28'35" East a distance of 360.20 feet; THENCE South 89°46'13" East, departing said proposed easterly right-of-way line of U.S. Highway 75, along the northerly line of said 18.551 acre tract, a distance of 229.49 feet to a 5/8 inch iron rod with plastic cap stamped with "KHA" set for corner; THENCE North 0°13'47" East, continuing along the northerly line of said 18.551 acre tract, a distance of 13.00 feet, to a 5/8 inch iron rod with plastic cap stamped with "KHA" set for corner; THENCE South 89°46'13" East, continuing along the northerly line of said 18.551 acre tract, a distance of 452.85 feet, to a 5/8 inch iron rod with plastic cap stamped with "KHA" set for corner; THENCE North 00°13'47" East, departing the northerly line of said 18.551 acre tract, and crossing aforesaid 107.52 acre tract, a distance of 86.00 feet to a 5/8 inch iron rod with plastic cap stamped with "KHA" set for corner; THENCE South 89°46'13" East, continuing across said 107.52 acre tract, a distance of 498.17 feet to a 5/8 inch iron rod with plastic cap stamped with "KHA" set for corner; THENCE South 0°13'47" West, continuing across said 107.52 acre tract, passing en route at a distance of 86.00 feet the northeast corner of aforesaid 18.551 acre tract, and continuing on said course along the easterly line of said 18.551 acre tract, a total distance of 601.80 feet to a 5/8 inch iron rod with plastic cap stamped with "KHA" set for corner at the beginning of a tangent curve to the right having a central angle of 60°17'02", a radius of 335.00 feet, a chord bearing and distance of South 30°22'17" West, 336.44 feet; THENCE in a southwesterly direction, continuing along the easterly line of said 18.551 acre tract, with said curve to the right, an arc distance of 352.47 feet to a 5/8 inch iron rod with plastic cap stamped with "KHA" set for corner at the end of said curve; THENCE South 60°33'48" West, continuing along the easterly line of said 18.551 acre tract, a distance of 6.34 feet to a 5/8 inch iron rod with plastic cap stamped with "KHA" set for corner; THENCE North 79°55'16" West, continuing along the easterly line of said 18.551 acre tract, a distance of 30.84 feet to a 5/8 inch iron rod with plastic cap stamped with "KHA" set for corner; THENCE South 49°37'03" West, continuing along the easterly line of said 18.551 acre tract, a distance of 69.97 feet to a 5/8 inch iron rod with plastic cap stamped with "KHA" set for corner at the beginning of a non-tangent curve to the right having a central angle of 09°04'37", a radius of 179.50 feet, a chord bearing and distance of South 35°50'39" East, 28.41 feet; THENCE in a southeasterly direction, continuing along the easterly line of said 18.551 acre tract, with said curve to the right, an arc distance of 28.44 feet to a 5/8 inch iron rod with plastic cap stamped with "KHA" set for corner at the beginning of a compound curve to the right having a central angle of 29°21'56", a radius of 90.00 feet, a chord bearing and distance of South 16°37'23" East, 45.62 feet; THENCE in a southeasterly direction, continuing along the easterly line of said 18.551 acre tract, with said compound curve to the right, an arc distance of 46.13 feet to a 5/8 inch iron rod with plastic cap stamped with "KHA" set for corner; THENCE South 01°56'25" East, continuing along the easterly line of said 18.551 acre tract, a distance of 151.55 feet to the POINT OF BEGINNING and containing 19.535 acres 850,935 square feet) of land, more or less. EXISTING RESTAURANT BLK A, LOT 2R PDC - COMMERCIAL EXISTING RETAIL BLK A, LOT 3R PDC - COMMERCIAL EXISTING RESTAURANT BLK A, LOT 4 PDC - COMMERCIAL EXISTING RESTAURANT BLK A, LOT 5 PDC - COMMERCIAL EXISTING RETAIL BLK 1, LOT 1 PDC - COMMERCIAL EXISTING RESTAURANT BLK A, LOT 9 PDC - COMMERCIAL EXISTING FUEL STATION BLK A, LOT 7 PDC - COMMERCIAL EXISTING RETAIL BLK A, LOT 6 PDC - COMMERCIAL EXISTING COMMERCIAL DEVELOPMENT BLK A, LOT 2 PDC - COMMERCIAL EXISTING RESTAURANT BLK A, LOT 10R PDC - COMMERCIAL UNDEVELOPED LAND BLK A, LOT 6R PDC - COMMERCIAL FUTURE HOTEL ABS A0782 TRACT 28 PDC (SUP) - COMMERCIAL FUTURE HOTEL ABS A0288 TRACT 33 PDC (SUP) - COMMERCIAL UNDEVELOPED LAND ABS A0288 TRACT 9 PDC - COMMERCIAL UNDEVELOPED LAND ABS A0752 TRACT 5 PDC - COMMERCIAL UNDEVELOPED LAND ABS A0782 TRACT 1 PDC - COMMERCIAL FUTURE RESIDENTIAL DEVELOPMENT BLK A, LOT 5 MF2 - MULTI-FAMILY RESIDENTIAL SOUTH THROCKMORTON BLVD BUDDY HAYES BLVD N89°42'17"W200.6'S89° 42' 17" E229. 1' N0° 23' 00" E 199. 89' N5 3 0 8 0 9 E 9 6 2 8 N28° 4 6' 5 1" W 26. 65' N57° 33 53 E152. 47 S57° 25 45 W151. 67 S5 3 0 6 5 5 W 9 9 2 7 S4 9 4 0 4 2 W6 97 1N79° 55' 03" W30. 99'S0°22'08"W 415.73' S0°22'08"W 185.07' S2 8 0 1 1 1 W 29. 3 1 N55° 38' 16" XX XUGE CC CC CC CC CC CC CC CC CC CC CC CC CC CC CC CC CC CC CC CC CC CC CC CC CC CC CC CC CC CC CC CC CC CC CC CC CC CC STORE NUMBER 6963-1006 BUILDING AREA = 186,933 S.F. / 4.29 AC 748 SPACES EXISTING RESTAURANT BLK A, LOT 2R PDC - COMMERCIAL EXISTING RETAIL BLK A, LOT 3R PDC - COMMERCIAL EXISTING RESTAURANT BLK A, LOT 4 PDC - COMMERCIAL EXISTING RESTAURANT BLK A, LOT 5 PDC - COMMERCIAL EXISTING RETAIL BLK 1, LOT 1 PDC - COMMERCIAL EXISTING RESTAURANT BLK A, LOT 9 PDC - COMMERCIAL EXISTING FUEL STATION BLK A, LOT 7 PDC - COMMERCIAL EXISTING RETAIL BLK A, LOT 6 PDC - COMMERCIAL EXISTING COMMERCIAL DEVELOPMENT BLK A, LOT 2 PDC - COMMERCIAL GARDEN AREA AUTOMOTIVE CARE AREA EXISTING RESTAURANT BLK A, LOT 10R PDC - COMMERCIAL UNDEVELOPED LAND BLK A, LOT 6R PDC - COMMERCIAL FUTURE HOTEL ABS A0782 TRACT 28 PDC (SUP) - COMMERCIAL FUTURE HOTEL ABS A0288 TRACT 33 PDC (SUP) - COMMERCIAL UNDEVELOPED LAND ABS A0288 TRACT 9 PDC - COMMERCIAL UNDEVELOPED LAND ABS A0752 TRACT 5 PDC - COMMERCIAL UNDEVELOPED LAND ABS A0782 TRACT 1 PDC - COMMERCIAL FUTURE RESIDENTIAL DEVELOPMENT BLK A, LOT 5 MF2 - MULTI-FAMILY RESIDENTIAL SOUTH THROCKMORTON BLVD BUDDY HAYESBLVDE GTGTBENCHMARK 1 BENCHMARK 2 BENCHMARK #3BENCHMARK #4 EXISTING LOADING ZONE EXISTING LOADING ZONE EXISTING DRIVE-THRU LANE EXISTING TRASH DUMPSTER AREA EXISTING STORM PIPE 15' WATER EASEMENT EXISTING LIGHT POLE EXISTING CURB EXISTING 24' FIRE LANE 5' BUILDING SETBACK 25' BUILDING SETBACK 5' BUILDING SETBACK 10' BUILDING SETBACK EXISTING SANITARY SEWER CLEANOUTS EXISTING CURB INLET EXISTING GRATE INLET EXISTING LIGHT POLE EXISTING GRATE INLET EXISTING 20' WATER EASEMENT EXISTING 10' UTILITY EASEMENT EXISTING LIGHT POLE EXISTING 10' UTILITY EASEMENT EXISTING 15' WATER EASEMENT EXISTING SANITARY SEWER MANHOLE EXISTING LIGHT POLE EXISTING FIRE HYDRANT EXISTING LIGHT POLE EXISTING 25' FIRELANE R 5 0 .0 ' R 3 0.0' R 3 0 . 0' R43. 6 R50. 0' R30. 0'R 3 0 0' R 10 0' R10. 0 'R 1 0 0'R 2 5 0'R 1 5. 0' R40. 0' S89° 49' 18" E8. 5' N89°42'17"W200.6'S89° 42'17" E229. 1' N0° 23' 00" E 199. 89' N5 3 0 8 0 9 E 9 6 2 8 N28° 4 6'5 1" W 26. 65'N57°33 53 E152.47 S57°25 45 W151.67 S5 30 65 5W 9 9 27 S4 9 4 0 4 2 W 6 9 7 1 N79° 55'03"W 30. 99' S0° 22' 08" W 415. 73' S0° 22'08" W 185.07'S2 8 0 1 1 1 W 29. 3 1 N55°38'16"W19. 34'N89° 37'26" W177.87'N63°33'51"W26.68'S89°36'31"E92.85'S89°36'32"E405.19'S89°38'16"E452.7'N0°23'36"E 85.96'R1 0 .0'R 5 0.0'R 5 0 .0 'R30.0 'R89. 1'R55. 0'R5 0.0 EXISTING ELECTRIC TRANSFORMER R20.0 'R25 . 0 'R 5 0 . 0 'R36. 0'R30.0'R16.0 'R30.0'R30. 0'R20. 0'R 2 5. 0'R30. 0'R45. 0'R33. 0'R 7 2.0 REFER TO ARCH FOR INTERNAL DIMENSIONS 18. 0' 25. 0' 40. 0'25.0' 40.0' 25.0'40.0'25.0'40.0'25.0'40.0'25.0' 40.0'25.0'40.0' 25.0'40.0'25.0'40.0'25.0'40.0' 25.0'18.0'9.0'25.0'24.0' 18.0'25.0'25.0'18.0'25. 0'36.0'30.0'36.0'36.0'18.0'18.0' 25.0'18.0'41.0'21.0'66.0'52.0'81.0' 24.0'15.0'28.0'24.0'6.7'9.5' TYP.24.0'9.5 15.2'20.0'8' BLACK ORNAMENTAL FENCE 8' BLACK ORNAMENTAL FENCE 5 D C B A 4321 2024 KIMLEY-HORN AND ASSOCIATES, INC.10101 REUNION PLACE, SUITE 400, SAN ANTONIO, TX 78216PHONE : 210-541-9166 FAX: 210-541-8699WWW.KIMLEY-HORN.COM TBPE FIRM NO. 928STORE# 6963-1006PREPARED FORWALMARTWAL-MART ANNA ADDITIONBLK A, LOT 1TEXASANNASITE PLANSITE PLAN DATA SITE NOTES 1.ALL WORK AND MATERIALS SHALL COMPLY WITH ALL CITY/COUNTY REGULATIONS AND CODES AND O.S. H.A. STANDARDS.2.CONTRACTOR SHALL REFER TO THE ARCHITECTURAL PLANS FOR EXACT LOCATIONS AND DIMENSIONS OF VESTIBULES, SLOPE PAVING, SIDEWALKS, EXIT PORCHES, TRUCK DOCKS,PRECISE BUILDING DIMENSIONS AND EXACT BUILDING UTILITY ENTRANCE LOCATIONS.3. ALL CURBED RADII ARE TO BE 3' OR 10' UNLESS OTHERWISE NOTED.4. ALL DIMENSIONS AND RADII ARE TO THE FACE OF CURB UNLESS OTHERWISE NOTED.5.EXISTING STRUCTURES WITHIN CONSTRUCTION LIMITS ARE TO BE ABANDONED, REMOVED OR RELOCATED AS NECESSARY. ALL COST SHALL BE INCLUDED IN BASE BID.6.CONTRACTOR SHALL BE RESPONSIBLE FOR ALL RELOCATIONS, (UNLESS OTHERWISE NOTED ON PLANS) INCLUDING BUT NOT LIMITED TO, Item No. 13. Planning & Zoning Commission Agenda Staff Report Meeting Date:12/2/2024 Staff Contact:Lauren Mecke AGENDA ITEM: Consider/Discuss/Action on a Resolution regarding the Walmart Anna Addition, Block A, Lot 1, Site Plan (SP 24-0007) Owner: Matt Philpott (Walmart Sr. Project Manager) SUMMARY: A retail store building on one lot on 18.53± acres, on the west side of S. Buddy Hayes Boulevard, 265± feet north of W. White Street. Zoned PD (Ord. 648-2014). The purpose of this site plan is to show the outdoor storage and screening for the commercial drone delivery hub at the southeast corner of the building. RECOMMENDATION: Recommended for approval subject to City Council approval of the zoning request. ATTACHMENTS: 1.Locator Map - Walmart Anna Addition, Block A, Lot 1 (SP 24-0007) 2.Resolution - Walmart Anna Addition, Block A, Lot 1 (SP 24-0007) 3.Exhibit A - Walmart Anna Addition, Block A, Lot 1 (SP 24-0007) PARKVIEW DR W WHITESTSCENTRALEXPYUS HIGHWAY 75HILLSIDE DR CREEK MEADOW DRTRAIL WOOD DR WILEY FARM S P R IN G VALLEYWAYLAKESHORE DR SBUDDY H A Y ESBLVDHILLTOPDRCREEKSIDEDRCREEKVIEW DRPERSI MMONDRS ST A N D R IDG EBLVDEast ForkTr i n it y R i v er121 V a n A l s t y n e 75 SH 121 SH 5 Subject Property City Limits ETJ0 400 800200 Feet November 2024 C:\Users\cbrooks\OneDrive - City of Anna\GIS\Notification Maps\ Notification Maps\ Anna Walmart Site Plan (SP 24-0007) Inset Map Anna Walmart Addition, Block A, Lot 1 Site Plan (SP 24-0007) CITY OF ANNA, TEXAS RESOLUTION NO. _______________ A RESOLUTION OF THE CITY OF ANNA, TEXAS APPROVING THE WALMART ANNA ADDITION, BLOCK A, LOT 1, SITE PLAN (SP 24-0007) WHEREAS, In order to provide for the orderly development of land within the Anna city limits and extraterritorial jurisdiction, the City Council of the City of Anna, Texas has adopted Article 9.02 (“Subdivision Regulation”) and Article 9.04 (“Zoning Ordinance”) of the Anna City Code of Ordinances; and WHEREAS, Matt Philpott (Walmart Sr. Project Manager) has submitted an application for the approval of the Anna Walmart Site Plan; and WHEREAS, the Site Plan conforms to the Planned Development Standards and the city’s Subdivision Regulations and Zoning Ordinance; and NOW THEREFORE, BE IT RESOLVED BY THE CITY COUNCIL OF THE CITY OF ANNA, TEXAS, THAT: Section 1. Recitals Incorporated The recitals above are incorporated herein as if set forth in full for all purposes. Section 2. Approval of Concept Plan The City Council hereby approves the Walmart Anna Addition, Block A, Lot 1, Site Plan attached hereto as Exhibit A. PASSED AND APPROVED by the City Council of the City of Anna, Texas, on this 14th day of January, 2025. ATTEST: APPROVED: City Secretary, Carrie L. Land Mayor, Pete Cain XX XUGE CC CC CC CC CC CC CC CC CC CC CC CC CC CC CC CC CC CC CC CC CC CC CC CC CC CC CC CC CC CC CC CC CC CC CC CC CC CC STORE NUMBER 6963-1006 BUILDING AREA = 186,933 S.F. / 4.29 AC 748 SPACES EXISTING RESTAURANT BLK A, LOT 2R PDC - COMMERCIAL EXISTING RETAIL BLK A, LOT 3R PDC - COMMERCIAL EXISTING RESTAURANT BLK A, LOT 4 PDC - COMMERCIAL EXISTING RESTAURANT BLK A, LOT 5 PDC - COMMERCIAL EXISTING RETAIL BLK 1, LOT 1 PDC - COMMERCIAL EXISTING RESTAURANT BLK A, LOT 9 PDC - COMMERCIAL EXISTING FUEL STATION BLK A, LOT 7 PDC - COMMERCIAL EXISTING RETAIL BLK A, LOT 6 PDC - COMMERCIAL EXISTING COMMERCIAL DEVELOPMENT BLK A, LOT 2 PDC - COMMERCIAL GARDEN AREA AUTOMOTIVE CARE AREA EXISTING RESTAURANT BLK A, LOT 10R PDC - COMMERCIAL UNDEVELOPED LAND BLK A, LOT 6R PDC - COMMERCIAL FUTURE HOTEL ABS A0782 TRACT 28 PDC (SUP) - COMMERCIAL FUTURE HOTEL ABS A0288 TRACT 33 PDC (SUP) - COMMERCIAL UNDEVELOPED LAND ABS A0288 TRACT 9 PDC - COMMERCIAL UNDEVELOPED LAND ABS A0752 TRACT 5 PDC - COMMERCIAL UNDEVELOPED LAND ABS A0782 TRACT 1 PDC - COMMERCIAL FUTURE RESIDENTIAL DEVELOPMENT BLK A, LOT 5 MF2 - MULTI-FAMILY RESIDENTIAL SOUTH THROCKMORTON BLVD BUDDY HAYESBLVDE GTGTBENCHMARK 1 BENCHMARK 2 BENCHMARK #3BENCHMARK #4 EXISTING LOADING ZONE EXISTING LOADING ZONE EXISTING DRIVE-THRU LANE EXISTING TRASH DUMPSTER AREA EXISTING STORM PIPE 15' WATER EASEMENT EXISTING LIGHT POLE EXISTING CURB EXISTING 24' FIRE LANE 5' BUILDING SETBACK 25' BUILDING SETBACK 5' BUILDING SETBACK 10' BUILDING SETBACK EXISTING SANITARY SEWER CLEANOUTS EXISTING CURB INLET EXISTING GRATE INLET EXISTING LIGHT POLE EXISTING GRATE INLET EXISTING 20' WATER EASEMENT EXISTING 10' UTILITY EASEMENT EXISTING LIGHT POLE EXISTING 10' UTILITY EASEMENT EXISTING 15' WATER EASEMENT EXISTING SANITARY SEWER MANHOLE EXISTING LIGHT POLE EXISTING FIRE HYDRANT EXISTING LIGHT POLE EXISTING 25' FIRELANE R 5 0 .0 ' R 3 0.0' R 3 0 . 0' R43. 6 R50. 0' R30. 0'R 3 0 0' R 10 0' R10. 0 'R 1 0 0'R 2 5 0'R 1 5. 0' R40. 0' S89° 49' 18" E8. 5' N89°42'17"W200.6'S89° 42'17" E229. 1' N0° 23' 00" E 199. 89' N5 3 0 8 0 9 E 9 6 2 8 N28° 4 6'5 1" W 26. 65'N57°33 53 E152.47 S57°25 45 W151.67 S5 30 65 5W 9 9 27 S4 9 4 0 4 2 W 6 9 7 1 N79° 55'03"W 30. 99' S0° 22' 08" W 415. 73' S0° 22'08" W 185.07'S2 8 0 1 1 1 W 29. 3 1 N55°38'16"W19. 34'N89° 37'26" W177.87'N63°33'51"W26.68'S89°36'31"E92.85'S89°36'32"E405.19'S89°38'16"E452.7'N0°23'36"E 85.96'R1 0 .0'R 5 0.0'R 5 0 .0 'R30.0 'R89. 1'R55. 0'R5 0.0 EXISTING ELECTRIC TRANSFORMER R20.0 'R25 . 0 'R 5 0 . 0 'R36. 0'R30.0'R16.0 'R30.0'R30. 0'R20. 0'R 2 5. 0'R30. 0'R45. 0'R33. 0'R 7 2.0 REFER TO ARCH FOR INTERNAL DIMENSIONS 18. 0' 25. 0' 40. 0'25.0' 40.0' 25.0'40.0'25.0'40.0'25.0'40.0'25.0' 40.0'25.0'40.0' 25.0'40.0'25.0'40.0'25.0'40.0' 25.0'18.0'9.0'25.0'24.0' 18.0'25.0'25.0'18.0'25. 0'36.0'30.0'36.0'36.0'18.0'18.0' 25.0'18.0'41.0'21.0'66.0'52.0'81.0' 24.0'15.0'28.0'24.0'6.7'9.5' TYP.24.0'9.5 15.2'20.0'8' BLACK ORNAMENTAL FENCE 8' BLACK ORNAMENTAL FENCE 5 D C B A 4321 2024 KIMLEY-HORN AND ASSOCIATES, INC.10101 REUNION PLACE, SUITE 400, SAN ANTONIO, TX 78216PHONE : 210-541-9166 FAX: 210-541-8699WWW.KIMLEY-HORN.COM TBPE FIRM NO. 928STORE# 6963-1006PREPARED FORWALMARTWAL-MART ANNA ADDITIONBLK A, LOT 1TEXASANNASITE PLANSITE PLAN DATA SITE NOTES 1.ALL WORK AND MATERIALS SHALL COMPLY WITH ALL CITY/COUNTY REGULATIONS AND CODES AND O.S. H.A. STANDARDS.2.CONTRACTOR SHALL REFER TO THE ARCHITECTURAL PLANS FOR EXACT LOCATIONS AND DIMENSIONS OF VESTIBULES, SLOPE PAVING, SIDEWALKS, EXIT PORCHES, TRUCK DOCKS,PRECISE BUILDING DIMENSIONS AND EXACT BUILDING UTILITY ENTRANCE LOCATIONS.3. ALL CURBED RADII ARE TO BE 3' OR 10' UNLESS OTHERWISE NOTED.4. ALL DIMENSIONS AND RADII ARE TO THE FACE OF CURB UNLESS OTHERWISE NOTED.5.EXISTING STRUCTURES WITHIN CONSTRUCTION LIMITS ARE TO BE ABANDONED, REMOVED OR RELOCATED AS NECESSARY. ALL COST SHALL BE INCLUDED IN BASE BID.6.CONTRACTOR SHALL BE RESPONSIBLE FOR ALL RELOCATIONS, (UNLESS OTHERWISE NOTED ON PLANS) INCLUDING BUT NOT